LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query NP_809341.1 (session:13574699)
CLUSTAL W (1.83) multiple sequence alignment


NP_809341.1               MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
GE2184A.1_435.396691      MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
                          ************************************************************

NP_809341.1               KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
GE2184A.1_435.396691      KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
                          ************************************************************

NP_809341.1               LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
GE2184A.1_435.396691      LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
                          ************************************************************

NP_809341.1               LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
GE2184A.1_435.396691      LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
                          ************************************************************

NP_809341.1               EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
GE2184A.1_435.396691      EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
                          ************************************************************

NP_809341.1               RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
GE2184A.1_435.396691      RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
                          ************************************************************

NP_809341.1               ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
GE2184A.1_435.396691      ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
                          ************************************************************

NP_809341.1               SEGKAVRVKDLRDNK
GE2184A.1_435.396691      SEGKAVRVKDLRDNK
                          ***************
Contact Webmaster JCSG Menu