LOADING...
   NP_638301.1;FK8795C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query NP_638301.1 (session:13288447)
CLUSTAL W (1.83) multiple sequence alignment


NP_638301.1               MPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFAR
FK8795C.1_141.371737      MPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFAR
                          ************************************************************

NP_638301.1               VISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYG
FK8795C.1_141.371737      VISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYG
                          ************************************************************

NP_638301.1               FTPPLFPQSLMERYVPGLYST
FK8795C.1_141.371737      FTPPLFPQSLMERYVPGLYST
                          *********************
Contact Webmaster JCSG Menu