LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query NP_251743.1 (session:13609842)
CLUSTAL W (1.83) multiple sequence alignment


NP_251743.1                 MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQ
SP16046A.22_335.419247      ---------------------SQAPVYGERLEGFDYAYPVHYLDFTSQGQ
SP16046A.1_335.413214       MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQ
                                                 *****************************

NP_251743.1                 PLSMAYLDVAPKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVD
SP16046A.22_335.419247      PLSMAYLDVAPKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVD
SP16046A.1_335.413214       PLSMAYLDVAPKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVD
                            **************************************************

NP_251743.1                 QVGFCKSSKPAHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATR
SP16046A.22_335.419247      QVGFCKSSKPAHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATR
SP16046A.1_335.413214       QVGFCKSSKPAHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATR
                            **************************************************

NP_251743.1                 YALLYPRQVERLVLVNPIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQ
SP16046A.22_335.419247      YALLYPRQVERLVLVNPIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQ
SP16046A.1_335.413214       YALLYPRQVERLVLVNPIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQ
                            **************************************************

NP_251743.1                 YQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSALTYDMIFTQPV
SP16046A.22_335.419247      YQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSALTYDMIFTQPV
SP16046A.1_335.413214       YQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSALTYDMIFTQPV
                            **************************************************

NP_251743.1                 VYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
SP16046A.22_335.419247      VYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
SP16046A.1_335.413214       VYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
                            **************************************************

NP_251743.1                 PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP
SP16046A.22_335.419247      PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP
SP16046A.1_335.413214       PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP
                            ***********************************
Contact Webmaster JCSG Menu