LOADING...

JCSG Sequence Search


The JCSG Sequence Search will BLAST your sequences against the JCSG sequence database. It is our hope that this information can further your research into your own protein whether structurally or biologically.
JCSG Sequence Search
Sequences:
OR
Sequence File:

Notes: This service searches the homologs of protein sequences against JCSG sequences. The protein sequences must be in FASTA format (uncompressed or compressed). The number of sequences must be less than or equal to 50.
>gi|18466607|ref|NP_569415.1| streptomycin phosphotransferase
MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRRGELAGERDRLIWLKGRGVACPEVIN
WQEEQEGACLVITAIPGVPAADLSGADLLKAWPSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRN
AVNPDFLPDEDKSTPQLDLLARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGT
ADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG
				

Contact Webmaster JCSG Menu