Homologs of:

1o50_A mol:protein length:157 Cbs Domain-Containing Predicted Protein Tm09
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# E-value %id Organism Protein Model Start MKVKDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYVARDNKLVGMIPVMHLLKVSGFHFFGFIPKEELIRSSMKRLIAKNASEIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVVDEKGEIVGDLNSLEILLALWKGREKEnd
3.000e-31 25  Trichodesmium erythraeum IMS101 gi|48891861||ref|ZP_00325310.1| COG0517: FOG: CBS domain [Trichodesmium erythrae protmod 1 MTNKIVSEVMSSNPITVKPKTPLKEAIKILAEKHISGLPVVDDNGKLVGIVSETDLMWIMLLDSIIFLENPGRYEKEIHKALGETVEEIMTNPLTTRSQERLSATAKLMNERSIHRLPVVDENGKVIGILTRGDIIRAMA..... 151
4.000e-31 25  Anabaena variabilis ATCC 29413 gi|45509869||ref|ZP_00162202.1| COG0517: FOG: CBS domain [Anabaena variabilis AT protmod 3 ...KTVADVMSHNPVVVKPETPLQEAIKILAERRISGLPVVDNDGKLLGIISETDLMWIMFLDSVIYLQNPAVYERDLHKALGQTVGEVMSNPVTVSPEKSVKQAAQLMHDRNVHRLPVLDDAGQVIGILTRGDIIRAMA..... 150
6.000e-31 25  Nostoc sp. PCC 7120 gi|17132947||dbj|BAB75512.1| alr3813 [Nostoc sp. PCC 7120] gi|17231305|ref|NP_48 protmod 3 ...KTVADVMSHNPVVVKPETPLQEAIKILAERRISGLPVVDNDGKLLGIISETDLMWIMFLDSVIYLQNPAVYERDLHKALGQTVGEVMSNPVTVSPEKSVKQAAQLMHDRNVHRLPVLDDAGQVIGILTRGDIIRAMA..... 150
2.000e-30 26  Thermosynechococcus elongatus BP-1 gi|22299345||ref|NP_682592.1| CBS domain protein [Thermosynechococcus elongatus protmod 5 .....VRDYMTPNPFTISADAPISEAVRLMEEKQVRGLPVVDDKGKLVGLVSEADLIYITFLGSIIYFESPESFHQHLKKTLGQQVQDVMTNPHTINVDAPISEAARLMVNHHISRLPVLNDQGELVGIISRHDLLRAL...... 149
8.000e-29 24  Nostoc punctiforme PCC 73102 gi|23127710||ref|ZP_00109573.1| COG0517: FOG: CBS domain [Nostoc punctiforme PCC protmod 3 ...KTVADVMSRDPIVVRAETPLKEAIQILAERHISGLPVVDDVGKLVGIISETDLMWIMFLDSVIYLKNPATYERDLHKALGQTVGEVMSNPIAISPDKTLKEAATIMHDRSVHRLPVLDGTDQVIGILTRGDIIRAMAASQE. 154
3.000e-28 20  Synechococcus elongatus PCC 6301 gi|56752279||ref|YP_172980.1| hypothetical protein syc2270_d [Synechococcus elon protmod 4 ....TVADFMTRDPISVKPQTPLTEAIRILADKHISGLPVVDEAGQLVGVLSETDLMWRESLDSFIYLENPARYEQELHKALGETVAEVMTQPLTIAADRPLPEAARLFNDRKVHRLFVLSGDHQVVGVITRGDIIRAMAQG... 153
1.000e-27 23  Arabidopsis thaliana gi|21537376||gb|AAM61717.1| unknown [Arabidopsis thaliana] gi|28827758|gb|AAO507 protmod 74 ..VYTVGEFMTKDLHVVKPTTTVDEALELLVENRITGFPVIDEDWKLVGLVSDYDLSGRTENSMFPEVDSTWKTFNAVQKLLSKTVGDLMTPPLVVEEKTNLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIK.. 229
4.000e-27 23  Synechocystis sp. PCC 6803 gi|16331252||ref|NP_441980.1| IMP dehydrogenase [Synechocystis sp. PCC 6803] gi| protmod 3 ...RTVGEVMTPNPITVKPDTPLQDAIRLLAENRISGMPVLDDQEKLVGVISDTDLMWVMLLDSIIYLQNPARHERELHKALGQTVGEVMNDPISILPTQTLREAAHLMNEKKIRRLPVLNESRQLIGILTQGDIIRAMARG... 153
6.000e-27 26  Streptomyces coelicolor A3(2) gi|7799276||emb|CAB90898.1| conserved hypothetical protein [Streptomyces coelico protmod 1 MKHQRVRDLMSDAVVRVQRGTPFKEIAHLLLEYDITAVPVVDEENRPVGVVSEADLQKMWGGEPDGSAEHAEWSRASAGKADATDAAGLMTSPPLCAESWSVVDAARVMARHRIKRLLVVDGDGRLAGVVSRSDLLRVFLR.... 143
10  1.000e-26 22  Oryza sativa (japonica cultivar-group) gi|50508236||dbj|BAD31758.1| putative CBS domain containing protein [Oryza sativ protmod 75 ....TVGDFMTKELHVVKSTTSVDEALEMLVEHRITGFPVIDDEWNLVGVVSDYDLNGLAEVDIFPEVDSTWKTFNEIQKLLSKTIGDVMTSPLVVRETTNLEDAARLLLETKYRRLPVVDSSGKLVGIITRGNVVRAALKIKKK 230
11  4.000e-26 25  Thermosynechococcus elongatus BP-1 gi|22298062||ref|NP_681309.1| polyA polymerase [Thermosynechococcus elongatus BP protmod 310 ....TAAELMSSPVRTVRPETPIADAHRVLLRYGHSGLSVVSAEGELLGIISRRDLDVALH-----------------HGFAHAPVKGYMKAPVTISPTTPLPEIQALMVQYDIGRLPVVNDQGDLVGIVTRTDVLRALNRDRE. 436
12  5.000e-26 21  Arabidopsis thaliana gi|15810601||gb|AAL07188.1| unknown protein [Arabidopsis thaliana] gi|13430838|g protmod 78 ....TVGDFMTPNLHVVKPSTSVDDALELLVEKKVTGLPVIDDNWTLVGVVSDYDLRSQNDTNLFPDVDSTWKTFNELQKLISKTVGDLMTPPLVVRDSTNLEDAARLLLETKFRRLPVVDADGKLIGILTRGNVVRAALQIKRE 233
13  2.000e-25 24  Chloroflexus aurantiacus gi|53796446||ref|ZP_00357413.1| COG0516: IMP dehydrogenase/GMP reductase [Chloro protmod 90 .KVKRSESGMITDPITLPPDRTVGDALDLMAEYKISGVPVTTADGDLVGIITNRDLRFETDR--------------------NRPIRDLMTNLVTVPEGTTLEEAKEVLHRHRIEKVLVVDERGKLSGMITVKDIMKRI...... 209
14  3.000e-25 24  Aquifex aeolicus VF5 gi|15607007||ref|NP_214389.1| inosine monophosphate dehydrogenase [Aquifex aeoli protmod 88 .KVKKSESGMIINPVTVKPDTRVKEALDIMAKYKISGVPVVDEERKLIGILTNRDLRFIKPEDY------------------SKPVSEFMTNLITAPEGITLDEAEEIFRKYKIEKLPIVDKEGKIKGLITIKDIVK........ 207
15  4.000e-25 21  Methanopyrus kandleri AV19 gi|20094343||ref|NP_614190.1| prdicted regulatory protein consisting of a unchar protmod 381 ....RVRDIMTESVVTASPDESIEDVARRLIEKEINHIPVVDEEGRIVGIVTSWDIAAAVAEG-------------------KRRLKDIMTDVITIRPHESVDEALRRMDRHNISCLPVVDGENRVVGIVTRTDITEVLRR.... 499
16  1.000e-24 21  Synechococcus elongatus PCC 6301 gi|56750577||ref|YP_171278.1| similar to polyA polymerase [Synechococcus elongat protmod 317 .....ARDLMSSPVRTVRPEIAIAEAERILLRYGHSGLSVVDEQDQLVGIISRRDLDLALH-----------------HGFGHAPVKGYMTHPKTIAPETSLPEIEDLMVTYDIGRLPVLDRN-QLVGIVTRTDVLRQLHQDQQR 439
17  1.000e-24 21  Synechococcus elongatus PCC 7942 gi|45512550||ref|ZP_00164116.1| COG0617: tRNA nucleotidyltransferase/poly(A) pol protmod 317 .....ARDLMSSPVRTVRPEIAIAEAERILLRYGHSGLSVVDEQDQLVGIISRRDLDLALH-----------------HGFGHAPVKGYMTHPKTIAPETSLPEIEDLMVTYDIGRLPVLDRN-QLVGIVTRTDVLRQLHQDQQR 439
18  2.000e-24 22  Nostoc punctiforme PCC 73102 gi|23130622||ref|ZP_00112435.1| COG0617: tRNA nucleotidyltransferase/poly(A) pol protmod 315 ....TARDLMSSPVRTILPETTIAEAQRILLRYGHSGLSVVDAQGQLVGIISRRDLDIALH-----------------HGFSHAPVKGYMTTNLTITPDTTLPQIESLMVTYDIGRLPVL-ENGQLVGLVTRTDVLRELHQERDE 438
19  2.000e-24 22  Thermus thermophilus HB8 gi|55980401||ref|YP_143698.1| `IMP dehydrogenase/GMP reductase [Thermus thermoph protmod 87 .KVKRSEAGMIQDPVTLPPTATLEDAERLMREYRIGGLPVVDVYGRLLGLVTNRDLRF--------------------ERDLKRPVTEVMTPVVTARPGTTLEEAEELLRRHKVEKLPLVDESGRLKGLITLKDIVK........ 205
20  2.000e-24 22  Methanosarcina acetivorans C2A gi|20092877||ref|NP_618952.1| hypothetical protein MA4084 [Methanosarcina acetiv protmod 78 ....TIEDLMTRNVVTIKENAPLEEVFSLFGKFPYHTFPVVNANNELVGII---DLDVVLEILLLCLVPRSKHTPLTAIRSLGGKARDIMTHPVTISLDATLKDASDLMMKHRFDRVCV-SNNGKLAGIISKKDLVKEICRRRKK 215
21  2.000e-24 22  Thermus thermophilus HB27 gi|46198372||ref|YP_004039.1| inosine-5`-monophosphate dehydrogenase [Thermus th protmod 87 .KVKRSEAGMIQDPVTLPPTATLEDAERLMREYRIGGLPVVDVYGRLLGLVTNRDLRF--------------------ERDLKRPVTEVMTPVVTARPGTTLEEAEELLRRHKVEKLPLVDESGRLKGLITLKDIVK........ 205
22  2.000e-24 24  Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough gi|46581178||ref|YP_011986.1| CBS domain protein/ACT domain protein [Desulfovibr protmod 3 .....IREWMTRNVITVTPDTSMMKASKLMKENGFRRLPVLDGNGKLIGIVSDRDIKEASPSKAT-----TLDMHELYYLLSEIKVKDIMTDPICVQPDETVERVALLMIEKHIGGMPVVDEEGQLVGIITDSDIFKVL...... 132
23  2.000e-24 19  Bradyrhizobium japonicum USDA 110 gi|27379757||ref|NP_771286.1| hypothetical protein blr4646 [Bradyrhizobium japon protmod 3 .....ARDVMVSPVVTVGPNATVRQVAQILLERRISAVPVVDADNKVLGIVSEGDLLHRSPSWWLRLLTGDAQLATDYVKSHSIKVQDVMTQEVTAAPETPLHEIAMLLEERQIKRVPIVNKEGQLVGIVSRANLLQTIASARPK 150
24  2.000e-24 29  Thermus thermophilus HB27 gi|46199411||ref|YP_005078.1| hypothetical protein TTC1109 [Thermus thermophilus protmod 1 MKVK---DLMTQDPVVLGPEATLEEAARRILETRYGGFPVVDGEGRLLGVVQVEELSDVEALQLFGEWVDEDALAEIYRRYQRTPVKAVMRTEIKVHPEDPLGKALKVVLTTDLRHLPVVDEEGKVVGILTRSDFLKLI...... 146
25  3.000e-24 21  Ralstonia eutropha JMP134 gi|53762531||ref|ZP_00168500.2| COG3448: CBS-domain-containing membrane protein protmod 249 .....VSEIMSRDVVTVNPSQPASEASHLLTRHRIKALPVVDEHRKLLGIITQSDFFAA--------------QRDTGARRLAGTVRDLMTRVVTARADQPMVELAQAFSDGGLHHAPVIDDHHRVVGMVTQSDLVAALLK.... 371
26  3.000e-24 20  Agrobacterium tumefaciens str. C58 gi|17935408||ref|NP_532198.1| hypothetical protein Atu1509 [Agrobacterium tumefa protmod 239 ......ASVMSRDVIGVAPDDSLRHAHALMHNHHFKALPVTNDKAEIVGIVTQTDLEKASWRNGRPSIGFLQRLRLSGASAPNDTVKDIMTSPVTVLPETSIEEAIIRFAEEGLHYLPVIDAKGKMVGIVSQSDVMVAMLADK.. 379
27  3.000e-24 21  Pyrococcus furiosus DSM 3638 gi|18976693||ref|NP_578050.1| related to inosine monophosphate dehydrogenase [Py protmod 130 ...RKVEEFMTKDVITLTPDDTVAKALATMRDHGISRIPVVDEEGKLEGLVTLHDLIIRFIKPRFR-AQAGELAGEKIPPFSMKLREAMIRGVITILPDATIREAVATMKDNNIDGLVVVDENNKVVGILTVKDLLLPISRMVEK 270
28  3.000e-24 22  Oryza sativa (japonica cultivar-group) gi|34015153||gb|AAQ56349.1| putative CBS domain containing protein [Oryza sativa protmod 30 ....TVGDFMTKELHVVKSTTSVDEALEMLVEHRITGFPVIDDEWNLVGVVSDYDLNGLAEVDIFPEVDSTWKTFNEIQKLLSKTIGDVMTSPLVVRETTNLEDAARLLLETKYRRLPVVDSSGKLVGIITRGNVVRAALKIKKK 185
29  3.000e-24 24  Methanosarcina mazei Go1 gi|21226935||ref|NP_632857.1| hypothetical protein MM0833 [Methanosarcina mazei protmod 59 ....TIEELMTRDLVTVNEDAPVEEVFSLFAKNPYHTLPVVNKKGELAGVI---DLDIVLEILLLCLMPRAKYTPLAARRSLGENAKEIMTHPVTISLNSTLKDVSDLMMKNRFDRVYV-SENGKLVGIISKRDLVKEICRQRK. 195
30  4.000e-24 22  Aquifex aeolicus VF5 gi|15605932||ref|NP_213309.1| hypothetical protein aq_438 [Aquifex aeolicus VF5] protmod 196 .....VRDYMTPNPITVSPNQTLKEVEEILSKHLIGGLPVVAK-GKLVGIVTKSDIQKVPSELR-----------------EKKRVYDVMTNLITVTEEESLAEVLRIFSSKGIGRLPVVKHKGELIGIITRADIGKAIREWKK. 319
31  4.000e-24 17  Crocosphaera watsonii WH 8501 gi|53735371||ref|ZP_00177827.2| COG0617: tRNA nucleotidyltransferase/poly(A) pol protmod 321 .....ARDLMSSPVRTIHPETTIEQAERVLFRYGHSGLSVVDEKDHLVGIISRRDLDLALH-----------------HGFSHAPVKGYMTKNITINPDTLLPDIESIMVTYDVGRLPVIDDN-RLLGIVTRTDLLRQIHQQRKE 443
32  4.000e-24 23  Oryza sativa (japonica cultivar-group) gi|51963706||ref|XP_506633.1| PREDICTED OJ1310_F05.16 gene product [Oryza sativa protmod 63 ..VYTVGDFMTKRPHVVTPATSVDEALETLVQHKISGFPVVDDTGKLVGVVSDYDLLALDSISMFPEVDSTWKTFREIQRLLSKTIADVMTSPLAVRESTNLDAATRLLLETKYRRLPVVDSTGKLVGMITRGTVVRAALKIKK. 221
33  5.000e-24 22  Trichodesmium erythraeum IMS101 gi|48890922||ref|ZP_00324519.1| COG0617: tRNA nucleotidyltransferase/poly(A) pol protmod 320 ....TAKDLMSSPVRTIPPETSIEEAHRILLRYNHSGLSVVDSSGKLVGIISRRDIDIALH-----------------HGFSHAPVKGYMTPQLTISPETNLPEIERLMVTYDIGRLPVL-ENNSLVGIVTRTDVLREL...... 437
34  8.000e-24 20  Methylobacillus flagellatus KT gi|53759475||ref|ZP_00350187.1| COG3448: CBS-domain-containing membrane protein protmod 237 ....TCGDIMSRDVVSVEYGTLLEEAWPLLLNHHIKALPVIDRAHRVIGIITRFDFMKHANLEAYPGFEEKLRKFIRRTFLVETDVGQIMTSKVTVSEDTHIVQLVPLLSERGIHHVPVLDHERRLVGIVTQTDLIAALYRGRLE 382
35  8.000e-24 22  Methanothermobacter thermautotrophicus str. Delta H gi|15678671||ref|NP_275786.1| hypothetical protein MTH644 [Methanothermobacter t protmod 3 ....RVKDAMQSDVITVKRTSSIHDAARVLRENRISGAPVVDEDGKLVGIISEGDIMRLIEVHPLRMKHEYDEIARGIRKAAVMRVEEIMTPVVTVPPHASVSDAAELMERHDIKRLPVIDENGRLAGIITRGDIIGAFVK.... 157
36  9.000e-24 20  Anabaena variabilis ATCC 29413 gi|53764756||ref|ZP_00160753.2| COG0617: tRNA nucleotidyltransferase/poly(A) pol protmod 315 ....TARDLMSSPVRTIRPETTIAEAQRILLRYGHSGLSVVNPQGQLVGIISRRDLDIALH-----------------HGFSHAPVKGYMTTDLTITPDTTLPQIESLMVTYDIGRLPVL-ANEQLVGIVTRTDVLRELHQN... 435
37  1.000e-23 22  Pseudomonas aeruginosa PAO1 gi|9947842||gb|AAG05243.1| conserved hypothetical protein [Pseudomonas aeruginos protmod 243 ....TAARIMSRDVQTASTETFIDDAWKQLQEHRLKALPVLDEHRRLAGIVTQSDLLKHFRPDGSPF--------KRLRFLRGTKLKTIMTTPVVVQADTHAVELVSLLSDEGLHCLPVLNEAGYLVGIVSQTDLIAALYRN... 373
38  1.000e-23 25  Thermotoga maritima MSB8 gi|15643897||ref|NP_228946.1| hypothetical protein TM1140 [Thermotoga maritima M protmod 3 .....VKDFMTRNPITIAPETSFSEALKLMKQNKIKRL-IVMKNEKIVGIVTEKDLLYASPSKATTLNIWELHYLLSKLK-----IEEIMTDVVTVNENTPIEDAARIMEEKDISGLPVVDDAGRLVGIITQTDIFKVFVE.... 133
39  2.000e-23 21  Pyrococcus abyssi gi|5458861||emb|CAB50348.1| Dehydrogenase, substrate unknown [Pyrococcus abyssi] protmod 130 ...RKVEEFMTKDVITLGPDDTVAKALATMRDHGISRIPVVDEEGKLEGLVTLHDLIIRFIKPRF-KAQYGELAGEKIPPFSMKLREAMIKGVITIMPEATIREAVSTMKDNNIDGLVVVDENNKVVGILTVKDLLLPISRMVEK 270
40  2.000e-23 21  Pseudomonas aeruginosa UCBPP-PA14 gi|53727931||ref|ZP_00139509.2| COG3448: CBS-domain-containing membrane protein protmod 243 ....TAARIMSRDVQTASTETFIDDAWKQLQDHRLKALPVLDEHRRLAGIVTQSDLLKHFRPDGSPF--------KRLRFLRGTKLKTIMTTPVVVQADTHAVELVSLLSDEGLHCLPVLNEAGYLVGIVSQTDLIAALYRN... 373
41  2.000e-23 19  Nostoc sp. gi|25533228||pir||AF2304 polyA polymerase [imported] - Nostoc sp. (strain PCC 71 protmod 315 ....TARDLMSSPVRTIRPETTIAEAQRILLRYGHSGLSVVNPQGQLVGIISRRDLDIALH-----------------HGFSHAPVKGYMTTDLTITPETTLPQIESLMVTYDIGRLPVL-ANEQLVGIVTRTDVLRELHQN... 435
42  3.000e-23 22  Bacteroides fragilis YCH46 gi|53715359||ref|YP_101351.1| inosine-5`-monophosphate dehydrogenase [Bacteroide protmod 89 .TVKRAENGMIYDPVTIKQGSTVRDALALMAEYKIGGIPVVDDNRYLVGIVTNRDLRF--------------------ERNMDKRIDEVMTNLVTTNQSTDLEAASQILQYHKIEKLPVVDKEGKLIGLVTYKDITKA....... 207
43  4.000e-23 18  Methylococcus capsulatus str. Bath gi|53757239||gb|AAU91530.1| CBS domain protein [Methylococcus capsulatus str. Ba protmod 297 ........IMTPEPLTAEFGDDLESVWRRMQRHGIRALPVVDRGRHVIGIVTFKDFFRHAPADGFGSLKARLKALLRVTSTKPEVVGQIMTAPITARHDAPIVELARLLSEHGIHQVPIVDERRKLVGLVTQTDLIAALYR.... 434
44  4.000e-23 23  Chloroflexus aurantiacus gi|53795309||ref|ZP_00356396.1| COG0517: FOG: CBS domain [Chloroflexus aurantiac protmod 3 .KTERVAEWMTENPVTVTPDFSVLAAYERMRARGIRRMPVVDKDGALVGIITRSDIEQAMSHPR-----SEEERRMARFSLAGQTVAEYMTNPITVAADASIGEAAAMMIRARVSGLPVMD-NGRLIGIITESDIFRLVA..... 136
45  7.000e-23 25  Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough gi|46580320||ref|YP_011128.1| CBS domain protein [Desulfovibrio vulgaris subsp. protmod 3 ....KARDIMTASPVTVAPDTEIAKAARILVERKFNGLPVVDDSGRLVGVICQSDLITQTVLDGFIPLTSMSELDEQMRRISATIVKHAMTDPVTVTPETAIDEIASLMVDSKLHTLPVV-ENGKLVGVIGKEDLLRTLA..... 148
46  7.000e-23 21  Idiomarina loihiensis L2TR gi|56460285||ref|YP_155566.1| Signaling protein with a cAMP-binding, CBS domains protmod 146 ...QTVGSVVSMPPVSLSSSTSVQEAAKLMASHGISSVLVVDDT-QLVGILTDRDLRNRVVAEGLP---------------LDVRVSSVMTQPESVYENRSLMDALTTMTSSNIHHLPVVNDQNQPVGMVTATDLIR........ 264
47  8.000e-23 20  Sinorhizobium meliloti 1021 gi|16262787||ref|NP_435580.1| hypothetical protein SMa0636 [Sinorhizobium melilo protmod 1 .........MTTKVVKLSPDDSVRQAAKLMFDHHVSGVPVVDDDGHLLGVISEGDLIRRAELCMADMAIDPDDRANAFIRRCSWRVGDVMTNPVTIEEEAPLARVAGLMQERGIKRIPVV-RDGELVGIVSRADLLQAIFSTK.. 140
48  9.000e-23 20  Synechocystis sp. PCC 6803 gi|16330751||ref|NP_441479.1| polyA polymerase [Synechocystis sp. PCC 6803] gi|1 protmod 331 .....ARDFMSSPVRTIRPHTTIEQAQRVLFRYGHSGLTVVNQEEKLVGIISRRDLDLALH-----------------HGFSHAPVKGYMTRNVTIAPDTPLPRIEAIMVADDVGRLPVMDQE-KLVGIVTRTDVLRQLLQDKQE 453
49  9.000e-23 25  Desulfotalea psychrophila LSv54 gi|51246911||ref|YP_066795.1| related to chloride channel protein [Desulfotalea protmod 468 MQGVRVSEVMRNRPVTVHKNQPISELLALFQETNLLGFPVVADDNKVWGIVTLQDMHKAESKPDF--------------SSKGLVVADIATDPITAFSDEPIWTAIQKMSPRDLARLPVVDGSGQLCGVISRSDILRA....... 594
50  1.000e-22 21  Pyrococcus horikoshii OT3 gi|14590496||ref|NP_142564.1| hypothetical protein PH0600 [Pyrococcus horikoshii protmod 130 ...KKVEEFMTKDVITLTPDDTVAKALAVMRDHGISRIPIVNEEGKLEGLVTLHDLILRFIKPRF-KAQTGELVGEKIPPFSMKLREAMIRGVITILPTATVREAVATMKDNDIDGLVVVDEGNKVVGILTVKDLLLPISRMVEK 270
51  1.000e-22 20  Silicibacter sp. TM1040 gi|52010207||ref|ZP_00337567.1| COG2905: Predicted signal-transduction protein c protmod 142 ....TVEQLMTRAPVTCTPETPIRDAAALMHRHHISSICICDPDG-FHGIVTLRDLNSKVIVGGIDPLE---------------PISGIMTDVLTLAPQALVTDVLHLMVERNIHHVPIVNERG-LLGIVTQTDLTRAQA..... 261
52  1.000e-22 24  Tropheryma whipplei TW08/27 gi|28572253||ref|NP_789033.1| inosine-5`-monophosphate dehydrogenase [Tropheryma protmod 87 .RVKLSESGMITRPVSVSPDLTLEEVEQRCSRYKISGFPVVDEDNTLLGIVTSRDM-----------WPYRHEHRASVR------VSEVMTPLITASPNISSEEARDLLYKHRLEKLPLVDEHGRLFGLITVKDFV......... 206
53  1.000e-22 24  Tropheryma whipplei str. Twist gi|28476082||gb|AAO44172.1| inosine-5`-monophosphate dehydrogenase [Tropheryma w protmod 87 .RVKLSESGMITRPVSVSPDLTLEEVEQRCSRYKISGFPVVDEDNTLLGIVTSRDM-----------WPYRHEHRASVR------VSEVMTPLITASPNISSEEARDLLYKHRLEKLPLVDEHGRLFGLITVKDFV......... 206
54  1.000e-22 25  Clostridium perfringens str. 13 gi|18145941||dbj|BAB81982.1| inositol-monophosphate dehydrogenase [Clostridium p protmod 85 .RVKRQENGVITDPIFLSEDHTVREALDLMAQYRISGVPVT-REGKLVGIITNRDIVFETNYD--------------------KKVSEVMTPLVTAKEGTTLTEALEILKQHKIEKLPLVDDENNLKGLITIKDIEKA....... 202
55  1.000e-22 20  Thermotoga maritima MSB8 gi|15644099||ref|NP_229148.1| inosine-5`-monophosphate dehydrogenase [Thermotoga protmod 82 ..VKKTENGIIYDPITVTPDMTVKEAIDLMAEYKIGGLPVVDEEGRLVGLLTNRDVRF--------------------EKNLSKKIKDLMTPLIVAPPDISLEKAKEILHQHRIEKLPLVSKDNKLVGLITIKDIMSVI...... 201
56  1.000e-22 22  Methanopyrus kandleri AV19 gi|20095036||ref|NP_614883.1| IMP dehydrogenase [Methanopyrus kandleri AV19] gi| protmod 92 .RVKEARDVVQRDVVTISPDESVKRAVELMEKHDVGGLPVVDEEGKVVGIITRRDVG-----------------LLSEEEIGELDVKSVMTEPVVIEEGEDLEEALRVMREEKIERVPVVDDEGRLLGIVTAKDVTE........ 212
57  2.000e-22 24  Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough gi|46579457||ref|YP_010265.1| inosine-5`-monophosphate dehydrogenase [Desulfovib protmod 85 .KVKKSESGMIIDPVTIAPGLTVRQALEVMAEYRVSGLPVV-ENDKLVGILTNRDVRF-------------------VKDLETTCVSEVMTNLVTVPVGTTLEEAKHHLHQHRIEKLLVVDGNNRLQGLITMKDIDKVV...... 204
58  2.000e-22 18  Fusobacterium nucleatum subsp. nucleatum ATCC 25586 gi|19704566||ref|NP_604128.1| Inosine-5`-monophosphate dehydrogenase [Fusobacter protmod 86 .RVKRSESGMITNPITLNKDSRVYQAEELMSRYKISGLPVIEDDGKLIGIITNRDIKY--------------------RKDLDQPVGDIMTSKITAPVGTTLEQAKEILLANRIEKLPITDQNGYLKGLITIKDI.......... 201
59  2.000e-22 23  Francisella tularensis subsp. tularensis Schu 4 gi|56708374||ref|YP_170270.1| Inosine-5-monophosphate dehydrogenase [Francisella protmod 85 .KVKRFENGMVIDPITIKQESSIKEIMQLAKEHNFSGFPVVDDNNKIIGIVTRRDFRFA--------------------KDLDEPVSSIMTPLVTVPEDASQGAIKKKLHEHKIEKLLVVNEQGELVGLITTKDIER........ 203
60  2.000e-22 22  Corynebacterium ammoniagenes gi|6705966||dbj|BAA89452.1| IMP dehydrogenase [Corynebacterium ammoniagenes] protmod 98 ..VKRSESGMVTDPVTANPDMTIQEVDDLCARFRISGLPVVNEDGTLLGICTNRDMRF--------------------ERDYSRKVSDIMTPLVVAKEGVSKEEALDLLSTNKVEKLPIVDKNNKLVGLITVKDFVKT....... 215
61  2.000e-22 25  Symbiobacterium thermophilum IAM 14863 gi|51892943||ref|YP_075634.1| putative poly A polymerase [Symbiobacterium thermo protmod 321 .....ARDVMSAPVKTILARKPIRDAERLMLRHGHTGLPVVDEQGRVVGVVSLRDVEKARR-----------------HGLEHAPVKSVMRSVIAVHPDTPADEVQELMIERDIGRVPVV-ADGNLVGIITRSDIL......... 434
62  2.000e-22 23  Methanococcoides burtonii DSM 6242 gi|41719874||ref|ZP_00148735.1| COG2021: Homoserine acetyltransferase [Methanoco protmod 367 LTHTSVADVMTEKVATIREGASIDTAAKVMFEEALTHLPVVNENGCLVGIVTSWDISKAVALKC-------------------SKLENIMTDVLTAFPDEPIVAAAKRMERHSISALPVVDEKNRLIGIIDSEDINRLI...... 487
63  2.000e-22 22  Thermococcus kodakaraensis KOD1 gi|57158453||dbj|BAD84383.1| inosine-5`-monophosphate dehydrogenase [Thermococcu protmod 91 .RVKRAERFIVEDVISIKPDESLDYALFLMERNGVDGLPVVDDEGRVVGVITKKDIAAK----------------------QGSKVSEVMTEVITVPETVTAEEAVQIMFDHRIDRLPVVDGEGRLVGIITMSDLAK........ 205
64  2.000e-22 21  Rhodospirillum rubrum gi|48763714||ref|ZP_00268268.1| COG0516: IMP dehydrogenase/GMP reductase [Rhodos protmod 83 .KVKRFESGMVVNPVTINPDASLSTALDLMAHHKISGIPVTNGSGKLVGILTNRDVRFA--------------------ENTAKPVSDFMTNLITVGEGVSQGEARRLLHTNRIEKLIVVDESYRCIGLITVKDMEKA....... 202
65  3.000e-22 18  Fusobacterium nucleatum subsp. vincentii ATCC 49256 gi|34762969||ref|ZP_00143947.1| Inosine-5`-monophosphate dehydrogenase [Fusobact protmod 87 .RVKRSESGMITNPITLNKDSRVYQAEELMSRYKISGLPVIEDDGKLIGIITNRDIKY--------------------RKDLDQPVGDIMTSKITAPVGTTLEQAKEILLANRIEKLPITDQNGYLKGLITIKDI.......... 202
66  3.000e-22 15  Magnetospirillum magnetotacticum MS-1 gi|46203958||ref|ZP_00209185.1| COG3448: CBS-domain-containing membrane protein protmod 238 ....TCASLLTRDVVAIAPEAPLREALTLLRRHHIKMLPVTDERARVLGVLTQTDLMDWDGRGPRLGFARRWQLTLGRGRAPHGCAADVMTTEVSLRPDMSLAQVAARMAQSGHHHLPVVGPDGRLVGVVSQSNLVAAL...... 376
67  3.000e-22 18  Corynebacterium efficiens YS-314 gi|23492445||dbj|BAC17418.1| IMP dehydrogenase [Corynebacterium efficiens YS-314 protmod 106 ..VKRSESGMVTDPVTCTPDMTIEEVDNLCARFRISGLPVVDKDGTLLGICTNRDMRFESDPNRL--------------------VTDVMTPMPLIVAEEGVEDALQLLSTHKVEKLPIVDKNNKLVGLITVKDFVKT....... 223
68  4.000e-22 19  Thermococcus kodakaraensis KOD1 gi|57159445||dbj|BAD85375.1| hypothetical protein, conserved, containing CBS dom protmod 131 ....KVEEYMTKDVITLKPSDTVAKALAVMRDHAISRIPIVNDEGKLEGLVTLHDLIIRFIKPRFRA--QAGEVAGEKIPPFSMPLRDVMIRVITILPDATVREAVATMKDNDIDGLVVVNEDNKVVGILTVKDLLLPISKMTEK 270
69  4.000e-22 23  Methanosarcina mazei Go1 gi|21226577||ref|NP_632499.1| putative inosine-5`-monophosphate dehydrogenase [M protmod 16 MKVK---DVMNPDVVFCKPENTVREAAKILKENNISGAPVL-EDGKLVGIVSEADLLELLVIPEKGNLWLPEETKKMLSDVGSTKLEEMMTKSVTISSEASVEEASELMVRHRINRLPVI-ENGYVVGIVTRGDIIEGLAK.... 168
70  4.000e-22 24  Desulfovibrio desulfuricans G20 gi|23475581||ref|ZP_00130866.1| COG0516: IMP dehydrogenase/GMP reductase [Desulf protmod 85 .KVKKSESGMIIDPVTIAPDYTVAQALQIMREYRVSGLPVV-KDAELVGILTNRDVRF-------------------VTDLEGTRVHEVMTSEVTVPVGTTLDEARHHLHEHRIEKLLVVDENNRLKGLITMKDI.......... 200
71  5.000e-22 15  Burkholderia cepacia R18194 gi|46314629||ref|ZP_00215214.1| COG3448: CBS-domain-containing membrane protein protmod 226 ......ADLMTKNAIEVAPSTSVTAALTLLDRHRVKALPVVDGEGRLTGIVTRADLTRQLRRPTPLWQRLSARLPQSFGGQPA-SVATVMTRDVCVPETMPITALVPLFTHSGHHHIPVVDASRRLVGIITQTDLVTGLYRQTQ. 363
72  6.000e-22 18  Thermobifida fusca gi|48835006||ref|ZP_00292008.1| COG0516: IMP dehydrogenase/GMP reductase [Thermo protmod 97 ..VKRSEAGMITHPVTCHPDDTLADVERLSAHYRISGAPVVDDDGRLVGIVTNRDMRF--------------------EEDRSRPVREVMTPLVTAPVGVSREEAFRLLRANKVEKLPLVDDEGRLRGLITVKDFTK........ 213
73  6.000e-22 24  Pseudomonas stutzeri gi|1684732||emb|CAA98155.1| ORF378 protein [Pseudomonas stutzeri] protmod 239 ....TAADITSRDVYSHTPDTFIEQAWSTLQRNRLRSLPVVSDSRELVGIVTLVDLLKHFHPRPGR------LNFGQLKFLRGTKLRAIMSSPVVVTADTHMVELVYLLSDRGLHCLPVVDAQRRLVGMITQTDLIAALYRN... 371
74  6.000e-22 20  Campylobacter upsaliensis RM3195 gi|57242158||ref|ZP_00370098.1| inosine-5`-monophosphate dehydrogenase [Campylob protmod 84 .RVKKSESGVIIDPIFIAPNASIYEALELMAEYRISGVPVVDEERKLLGILTNRDLRFESNFNN--------------------RVENVMTPLITAPKGCTLDDAEKIFSTNKVEKLPIVDESNHLVGLITIKDLKK........ 201
75  6.000e-22 20  Geobacillus kaustophilus HTA426 gi|56421343||ref|YP_148661.1| acetoin utilization protein [Geobacillus kaustophi protmod 3 .....VEQVMKAPVITLRATNTIAEALQLLRHHRIRHLPVVDEEGRLLGLVTSQDLRDASPSIFHLHEHLED---------LQKPVSTIMTDLIVGHPLDFVEEVAALFYEHRIGCLPIVN-HGKLVGIITQTDLLRTFIE.... 129
76  7.000e-22 20  Novosphingobium aromaticivorans DSM 12444 gi|48849488||ref|ZP_00303731.1| COG0516: IMP dehydrogenase/GMP reductase [Novosp protmod 99 ..VKRFESGMVVNPITISPDAPLGEAQALMRQHKISGIPVVEASGKLVGILTNRDVRFADNPQ--------------------QPVRELMTNLATVKLGSSGDEARRLLHQRRIEKLLVVDDAFHCIGLITVKDIEKAV...... 217
77  8.000e-22 15  Nocardia farcinica IFM 10152 gi|54022862||ref|YP_117104.1| putative inosine-5`-monophosphate dehydrogenase [N protmod 80 .TVKRSEAGMVTDPVTCRPTDTLAEVDAMCARFRISGLPVVDETGALVGIITNRDMRFEVD--------------------QNRRVADVMTPLITAQEGVTAEAALGLLRRHKVEKLPIVDGNGRLRGLITVKDFVKT....... 198
78  8.000e-22 21  Corynebacterium diphtheriae NCTC 13129 gi|38233189||ref|NP_938956.1| inosine-5`-monophosphate dehydrogenase [Corynebact protmod 97 .TVKRSESGMVTDPVTCSPDMSISEVDALCARFRISGIPVVDSEGKLLGICTNRDMRF--------------------EQNFDRKVSEVMTPLVVAEEGVTKEQALSLLSTNKVEKLPIVDKQGKLVGLITVKDFVKT....... 215
79  9.000e-22 21  Lactococcus lactis subsp. lactis Il1403 gi|15672202||ref|NP_266376.1| IMP dehydrogenase [Lactococcus lactis subsp. lacti protmod 89 .KVKRSESGVITDPFFLTPNHKIEEAENLMATYRISGVPIVDENRKLVGIITNRDLRFITD--------------------YNQQIKNMMTNLITAPVGTTLDTAARILQEHKIEKLPLVDEAGKLAGLITIKDIERVI...... 210
80  9.000e-22 25  Methanococcus maripaludis S2 gi|45358922||ref|NP_988479.1| hypothetical protein MMP1359 [Methanococcus maripa protmod 386 .KMKLVKDILSRPVVVGSLNTSITQASRVLIENNINHLPIVDENGKLSGIITSWDIAKAMAQD-------------------KHSISEIMTTIVSATPDETIDMAARKMSRNNISGLPVVDSNNKVLGVVSAEDISKLIGRN... 508
81  9.000e-22 16  Rhodopseudomonas palustris CGA009 gi|39937306||ref|NP_949582.1| CBS domain:Transport-associated domain [Rhodopseud protmod 2 ....RAHQIMTRQLVTIGPEASIVDAANAMIDNHVSGLPVVDDDGKLIGIISEGDFIRRARGRWLRMLLGPGTCAGDFVHEHGRKVGEVMTHPYTISEDTSIETIVKLMEKHHVKRFPVMRGD-LLVGIVTRKNLLRAVA..... 144
82  1.000e-21 21  Corynebacterium glutamicum ATCC 13032 gi|21323368||dbj|BAB97996.1| IMP dehydrogenase/GMP reductase [Corynebacterium gl protmod 99 ..VKRSESGMVTDPVTCTPDMSIQEVDDLCARFRISGLPVVDEAGKLVGICTNRDMRFESD--------------------MNRRVAEVMTPLVVAEEGVTKEQALALLSANKVEKLPIIAKDGKLVGLITVKDFVKT....... 216
83  1.000e-21 17  Bifidobacterium longum NCC2705 gi|23466267||ref|NP_696870.1| inosine-5`-monophosphate dehydrogenase [Bifidobact protmod 131 ..VKRSESGMITDPLTVNPEVTLADLDKLCGKFHISGLPVVDKENKLVGIITNRDMRFIASEDYD-----------------TLKVKDVMTNLVTGPSNISKDDAHRLLAQHKVEKLPLVDEEGHLTGLITVKDFVKT....... 251
84  1.000e-21 17  Streptomyces coelicolor A3(2) gi|3618249||emb|CAA09265.1| inosine 5` monophosphate dehydrogenase [Streptomyces protmod 116 ...KRSESGMVANPITIHPDSTLAEADALCAKFRISGVPVTDGAGKLLGIVTNRDMAFETDR--------------------SRQVREVMTPMPLVTGQVGISEAMDLLRRHKIEKLPLVDGDGILKGLITVKDFVKA....... 232
85  1.000e-21 21  Cytophaga hutchinsonii gi|48855646||ref|ZP_00309804.1| COG0516: IMP dehydrogenase/GMP reductase [Cytoph protmod 89 .RVKRSESGMIMDPIVLQEDALLKDALKIMKDFKIGGIPVLDKNKRLVGILTNRDLRF--------------------QKNVNKPISKIMTNLVTAPEGIDLAKAEEILQKYKIEKLPIVDKQGKLKGLITYRDILK........ 206
86  1.000e-21 16  Zymomonas mobilis subsp. mobilis ZM4 gi|56543791||gb|AAV89945.1| IMP dehydrogenase [Zymomonas mobilis subsp. mobilis protmod 84 ..VKRYESGMVVNPITITPNSNLREARALMDKYQISGIPVVEASGRLAGILTNRDVRFA--------------------EHLDQPVSELMTNLATVKPGVTQDEARRLLHQRRIEKLLVVDDNYHCLGLITVKDIEKSVA..... 203
87  1.000e-21 16  Streptomyces coelicolor A3(2) gi|7320889||emb|CAB82009.1| inosine 5` monophosphate dehydrogenase [Streptomyces protmod 94 ..VKRSESGMVANPITIHPDATLGEADALCAKFRISGVPVTDGAGKLLGIVTNRDMAFETDR--------------------SRQVREVMTPMPLVTGQVGISDAMELLRRHKIEKLPLVDGDGILKGLITVKDFVKA....... 211
88  1.000e-21 26  Methanocaldococcus jannaschii DSM 2661 gi|15668271||ref|NP_247064.1| hypothetical protein MJ0100 [Methanocaldococcus ja protmod 390 .....VKDILSKPPITAHSNISIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQN-------------------KKTIEEIMTNVITAHEDEPVDHVAIKMSKYNISGVPVVDDYRRVVGIVTSEDISR........ 503
89  1.000e-21 18  Synechocystis sp. PCC 6803 gi|16331172||ref|NP_441900.1| chloride channel protein [Synechocystis sp. PCC 68 protmod 454 ....RAGQVMKTEVESLEQSLTLAQVLPIMSNSHHRGFPVV-QGGKLVGVFTQTDL------------------ANAAQESVHIALKQIMTNPITVDPEAPLSDVLYLLNRYQLSRLPVVEGDNKLVGIITRTDIIRE....... 569
90  1.000e-21 25  Thermotoga maritima MSB8 gi|15643592||ref|NP_228638.1| hypothetical protein TM0829 [Thermotoga maritima M protmod 2 ....RVKDAVIYDISAVFEDETVETVIKLLSRQNLSGVPVVDHDMRVVGFVSESDLIKALVPSYFSFIPDTNQLIRNVVKIKDRPVSEFMKPPVVVKEDDPLIVAADYLIRHGFKSLPVVDEAMQLVGIVRRIDILRVVSEGKLE 149
91  2.000e-21 21  Campylobacter jejuni RM1221 gi|57237943||ref|YP_179191.1| inosine-5`-monophosphate dehydrogenase [Campylobac protmod 84 .RVKKSESGVIIDPIFVSPKASVAEALEIMAEYRISGVPVVDEDKKLIGILTNRDLRFESDFSNL--------------------VENVMTPLITAPKGCTLDDAEKIFSTNKVEKLPIVDEQGRLEGLITIKDLKK........ 201
92  2.000e-21 17  Dechloromonas aromatica RCB gi|53730603||ref|ZP_00151382.2| COG0516: IMP dehydrogenase/GMP reductase [Dechlo protmod 84 .KVKRFESGILKDPITVSPLMTVRDVIEITRQYKISGLPVIDKSGKVVGIVTNRDMRFETN--------------------LDQPVKAIMTPLVTVKEGASVEDAKELIRRHRLERVLVIDDEWHMRGLITVKDILK........ 202
93  2.000e-21 25  Methanosarcina barkeri str. fusaro gi|48840939||ref|ZP_00297865.1| COG0517: FOG: CBS domain [Methanosarcina barkeri protmod 63 ....TIGELMTREVIKVYENTSVEEILSLYGKYPYHILPVVNDKNELVGTI---DLDTILGILLLCLMPREKYTLTTAIRSLGETAKEIMTHPITVSLNATLKDASDLMIKYRLDRICVI-EDRKLVGIVSKRDLVEEICRRRKE 200
94  2.000e-21 17  Geobacter sulfurreducens PCA gi|39996900||ref|NP_952851.1| CBS domain protein [Geobacter sulfurreducens PCA] protmod 2 ...KTVRDIMTTNVVTARRETTIRELAELFSKYRIGSIPVVDEAGNLAGIVTESDLIEISLFDWVIYLESAKKFEREIQKVTGQTAGDIYTTEVSVTPETPVSTVADIMANKKLHTLPVV-EGKKLVGIVSRIDLIRTM...... 147
95  2.000e-21 23  Thermoanaerobacter tengcongensis MB4 gi|20807078||ref|NP_622249.1| IMP dehydrogenase/GMP reductase [Thermoanaerobacte protmod 86 .KVKRSEHGVITDPFSLSPDHTIRDAAELMARYKISGVPITVDS-KLVGIITNRDIRF--------------------EDDLDKPIREVMTNLVTAPPGTTLEEAKQILKKHKIEKLPLVDENNVLKGLITIKDIEKAV...... 204
96  2.000e-21 20  Rubrivivax gelatinosus PM1 gi|47573714||ref|ZP_00243752.1| COG3448: CBS-domain-containing membrane protein protmod 233 ......ADIMTREVVTVSFGTELQDAWALLREHRIKALPVVDRARRVVGIVTLADFLRH--ADLDVHEGWSARLRSFIRRTPATHVGQIMTRQVRVSEDRPVAELVPLFAQGGHHHIPIVGPEARLVGMLTQSDVVSALSR.... 372
97  2.000e-21 20  Bacteroides thetaiotaomicron VPI-5482 gi|29349253||ref|NP_812756.1| inosine-5`-monophosphate dehydrogenase [Bacteroide protmod 90 ..VKRAENGMIYDPVTIKRGSTVSDALGIMAEYKIGGIPVVDDEGYLVGIVTNRDLRF--------------------ERDMTKHIDLVMTPKVTTNQSTDLESAAQILQKHKIEKLPIVGMDGKLIGLVTYKDITKA....... 208
98  2.000e-21 21  Campylobacter jejuni subsp. jejuni NCTC 11168 gi|6968494||emb|CAB73314.1| inosine-5`-monophosphate dehydrogenase [Campylobacte protmod 84 .RVKKSESGVIIDPIFVSPKASVAEALEIMAEYRISGVPVVDEDKKLIGILTNRDLRFESDFSNL--------------------VENVMTPLITAPKGCTLDDAEKIFSTNKVEKLPIVDEQGRLEGLITIKDLKK........ 201
99  3.000e-21 13  Ralstonia solanacearum gi|17427138||emb|CAD13658.1| PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacea protmod 236 ....TCADIMTPSVVTASAATSVPHALRLLQRHGVKALPVIDDGRRLIGIVTRADLAGTAPRAPRQRLRDWF----AIGAMTPPRVRGVMNPRVTIRADAPMADLVPMFASAGHHHIPVVDAHGRLAGILTQADVIHALYRQ... 370
100  3.000e-21 20  Bacillus clausii KSM-K16 gi|56961793||ref|YP_173515.1| inosine-5`-monophosphate dehydrogenase [Bacillus c protmod 87 .KVKRSESGVITDPFFLTPDRQVFDAEHLMGKYRISGVPIVDEEQKLVGILTNRDLRFI--------------------EDYSIKIDDVMTKEVTAPVGTTLEQAEKILQQHKIEKLPLVDDNGILKGLITIKDIEKVI...... 206
101  3.000e-21 18  Bradyrhizobium japonicum USDA 110 gi|27379083||ref|NP_770612.1| inosine-5`-monophosphate dehydrogenase [Bradyrhizo protmod 90 ..VKRYESGMVVNPLTISPEATLDDALKLMSDHGISGIPVVTGAGKLVGILTNRDVRFATDR--------------------RQKVSELMTHEVTVRENVSQDEARRMLHQHRIEKLLVVDEQYRCVGLVTVKDMEKAVA..... 214
102  3.000e-21 17  Bifidobacterium longum DJO10A gi|46190983||ref|ZP_00120794.2| COG0516: IMP dehydrogenase/GMP reductase [Bifido protmod 73 ..VKRSESGMITDPLTVNPEVTLADLDKLCGKFHISGLPVVDKENKLVGIITNRDMRFIASEDYD-----------------TLKVKDVMTNLVTGPSNISKDDAHRLLAQHKVEKLPLVDEEGHLTGLITVKDFVKT....... 193
103  3.000e-21 17  Streptomyces avermitilis MA-4680 gi|29608659||dbj|BAC72712.1| putative inosine-5`-monophosphate dehydrogenase [St protmod 94 ..VKRSESGMVTDPITVHPDATLAEADAICAKFRISGVPVTDGNGKLLGIVTNRDMAFETDR--------------------SRQVREVMTPLVTGKVGISGNDAMQLLRRHKIEKLPLVDDAGILKGLITVKDFTKA....... 211
104  3.000e-21 19  Bradyrhizobium japonicum USDA 110 gi|27379751||ref|NP_771280.1| hypothetical protein bll4640 [Bradyrhizobium japon protmod 2 ....RAYQIMSRQVVSIRPEAPITDAIKVMLAHHISGLPVVDSADNLVGIICESDFLRRSRNRLLSLLLGAERVASEFVKERGRKVEQVMTRPVTTNEQAPLDEVADVMERRHLNHIPVMRAD-RIVGIITRSDFLSAVA..... 144
105  3.000e-21 25  Idiomarina loihiensis L2TR gi|56459687||ref|YP_154968.1| IMP dehydrogenase [Idiomarina loihiensis L2TR] gi| protmod 85 .KVKKYESGMVSDPVTVRPTTTIGEIKKLTAEHGFQGFPVVEGNGDLVGIVTGRD--------------------TRFEDDDSKEIRHVMTRLVTVHETAESEEILQLMHKHRIEKILVVDDAHKLKGMITLKDFEKA....... 204
106  3.000e-21 21  Magnetospirillum magnetotacticum MS-1 gi|23016740||ref|ZP_00056493.1| COG0516: IMP dehydrogenase/GMP reductase [Magnet protmod 83 .KVKKFESGMVVNPLTIHPDQTLADALRLMSDYKISGIPVVERSGKLVGILTNRDVRFANDA--------------------AQPVYELMTKLVTVREGVDKEEAKRLLHQHRIEKLLVVDSDYRCIGLVTVKDMEKAQA..... 204
107  3.000e-21 17  Synechococcus sp. WH 8102 gi|33865304||ref|NP_896863.1| similar to IMP dehydrogenase [Synechococcus sp. WH protmod 1 .........MTQPVLSVTPDTPLQQAVQLISDHHISGLPVVDDAGVLIGELSEQDQMYVMLLDSVIYLRNPLNWDKQVHQVLGTTVKDLMRDTHTCSLELGLPKAASQLHDRSTQRLFVLDGDGKPAGVITRGDVMRALASHKE. 146
108  3.000e-21 20  Brucella suis 1330 gi|23463698||gb|AAN33550.1| inosine-5`-monophosphate dehydrogenase [Brucella sui protmod 91 ..VKKFESGMVVNPVTIGPDATLADAQALMKAHGISGIPVVENAGRLVGILTNRDVRFASDPK--------------------QKIYELMTNLITVHENVNQDEAKRLLHSHRIEKLLVVDDKGRCVGLVTVKDIEK........ 211
109  3.000e-21 26  Archaeoglobus fulgidus DSM 4304 gi|11498786||ref|NP_070015.1| hypothetical protein AF1186 [Archaeoglobus fulgidu protmod 372 ..VKVVKSVMV-EAYTISPETAIEEAARIMMDKGINHIPVV-EEGRLVGIITSWDIAKAVARNRKGA------------------VKSIMTNVIYTHPDEPVEVAARKMEQNNISALPVVDSRKRVLGIVTSEDLSKLIAR.... 491
110  4.000e-21 20  Bacillus halodurans gi|34395726||sp|Q9KGN8|IMDH_BACHD Inosine-5`-monophosphate dehydrogenase (IMP de protmod 87 .RVKRSESGVITNPFFLTPDRQVFDAEHLMGKYRISGVPIVDEDQKLVGILTNRDLRFI--------------------EDYSTLIDDVMTNLVTAPVGTTLKEAEEILQKHKIEKLPLVDESGTLKGLITIKDIEKVI...... 206
111  4.000e-21 26  Bradyrhizobium japonicum USDA 110 gi|27381185||ref|NP_772714.1| hypothetical protein blr6074 [Bradyrhizobium japon protmod 2 ....RAHQIMTRSVISVTPDTSIVEAANIMLKRHVSGLTVVDDTGKLVGVVSEGDFIRRSRGRWLRFILGPGKSASDFVHEHGRKVSEVMTSPVTITEDTALAEIVDLMERNNVKRLPVVRGDM-VVGIVSRANLLQAVA..... 144
112  4.000e-21 20  Legionella pneumophila subsp. pneumophila str. Philadelphia 1 gi|52841951||ref|YP_095750.1| inosine-5`-monophosphate dehydrogenase [Legionella protmod 86 .RVKKFESGMVKDPISVTPDLTVKELLAVMTKYNFSGVPVVDGK-HLVGIVTSRDIRFETN--------------------MNLTVAQVMTPKVTVKEGASREEVRSLLHKHRIEKLLVVNENFELRGLITVKDIQKA....... 204
113  4.000e-21 20  Heliobacillus mobilis gi|27262442||gb|AAN87502.1| Inosine-5`-monophosphate dehydrogenase [Heliobacillu protmod 102 .RVKRSEHGVITDPIYLTPKHKINDALAIMERYHISGVPIADEEGKLVGILTNRDLRFETEF--------------------SRPISDVMTNLVTAPIGTSLKEAKDILRNHKVEKLPIVDVEGHLKGLITIKDIQKA....... 220
114  4.000e-21 21  Methanococcoides burtonii DSM 6242 gi|46142418||ref|ZP_00149100.2| COG1900: Uncharacterized conserved protein [Meth protmod 371 MKLSRVGDIMTSDVSIIQAEASFNDAAKTIMDKQFSHLPVVDKDNSLVGIVTAWDISKAVA------------------KAEYDLVKDIMTDVVTTSPDEAIDIAAFKLDSNNVSALPVIDAKKQVVGIITSDDISKLLARRQ.. 500
115  5.000e-21 24  Thermus thermophilus HB27 gi|46198411||ref|YP_004078.1| acetoin utilization acuB protein [Thermus thermoph protmod 3 .....VRDVMKSPVLTVGPEATLEEAYKLLLERGIRHLPVV-EEGRLVGIVTDRDIRLATS-HLNPKGPCPG----------CTRVGEVMTRVVTAHPLDPVEEAARVMRERKIGCLPVL-EDEALVGIVTGIDLLDALLR.... 126
116  5.000e-21 17  Propionibacterium acnes KPA171202 gi|50843228||ref|YP_056455.1| IMP dehydrogenase / GMP reductase [Propionibacteri protmod 95 ..VKRSEAGMIDEPITISPNATLADAEELCHTYRISGVPVVDDKENLVGIITNRDMRFEDNPQ--------------------RPICEVMTPLVTAPVGTSPSDALSLLAAHKIEKLPLVDADGKLRGLFTLKDFVKT....... 212
117  6.000e-21 20  uncultured archaeon GZfos12E1 gi|52632000||gb|AAU85400.1| inosine-5`-monophosphate dehydrogenase [uncultured a protmod 1 MQTKTVKELMTTDVIAFKPGEKIPHVVKAFRTNRISGAPVIDDQRKVIGIISEADIMKLTATVPFPDIDPLNKIPDEIETLFEGYVKDVMTKKVTISPDNSISDAARLMHKNDFKRIPVVDDEGKLVGVIARGDVIGVFAK.... 160
118  6.000e-21 21  Bartonella henselae str. Houston-1 gi|49474993||ref|YP_033034.1| Inosine-5-prime-monophosphate dehydrogenase [Barto protmod 91 ..VKKFESGMVVNPVTIGPDATLEEAKALMRSHGISGIPVVENAGRLVGILTNRDVRFASD--------------------LKQKIYELMTNLITVRENVQLNEAKYLLHHHRIEKLLVVDEHNRCVGLITVKDIEKA....... 214
119  7.000e-21 18  Campylobacter coli RM2228 gi|57167939||ref|ZP_00367078.1| inosine-5`-monophosphate dehydrogenase [Campylob protmod 84 .RVKKSESGVIIDPIFVGPKASVAEALEIMAEYRISGVPVIDSDRKLIGILTNRDLRFENDYSNL--------------------VENVMTPLITAPKGCTLDDAEKIFSKNKVEKLPIVDEQGRLEGLITIKDLKK........ 201
120  7.000e-21 32  Chloroflexus aurantiacus gi|53795190||ref|ZP_00356283.1| COG0517: FOG: CBS domain [Chloroflexus aurantiac protmod 277 .TAKTVGEVMIRDVPTVTPETPLAETLDRILSTPRRRVVVVDQNRRVVGIISDGDILRRAARPWIGGGARPPELELALKNL---TAAAVMTSPVTVNPDTPIISAVELMIERRIKRLPVVDEEGRLVGMV............... 414
121  7.000e-21 20  Mycobacterium tuberculosis H37Rv gi|15610547||ref|NP_217928.1| PROBABLE INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE GU protmod 122 ..VKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVD--------------------QSKQVAEVMTPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKT....... 239
122  7.000e-21 21  Haemophilus somnus 129PT gi|53692760||ref|ZP_00122068.2| COG0516: IMP dehydrogenase/GMP reductase [Haemop protmod 42 .KVKKFESGIVSEPVTVSPTMTLTELAELAKKNGFAGYPVVDEQKGLVGIITGRD--------------------TRFVSDLNKTVADFMTPKVTVKEGATREEIFHLMHEHRVEKVLVVDDSFKLKGMITLKDYQKAESK.... 164
123  7.000e-21 18  Mycobacterium avium subsp. paratuberculosis str. k10 gi|41410376||ref|NP_963212.1| GuaB2 [Mycobacterium avium subsp. paratuberculosis protmod 122 ..VKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDSGALVGIITNRDMRFEVD--------------------QTKKVAEVMTPLITAQEGVSADAALGLLRRNKIEKLPIVDGHGRLTGLITVKDFVKT....... 239
124  7.000e-21 18  Mycobacterium leprae TN gi|15827114||ref|NP_301377.1| putative inosine-5`-monophosphate dehydrogenase [M protmod 121 .TVKRSEAGMVTDPVTCRPDNTLAQVGALCARFRISGLPVVDDSGALAGIITNRDMRFEVD--------------------QSKQVAEVMTPLITAAEGVSADAALGLLRRNKIEKLPVVDGHGRLTGLITVKDFVKT....... 239
125  7.000e-21 22  Haemophilus influenzae 86-028NP gi|48868437||ref|ZP_00321771.1| COG0516: IMP dehydrogenase/GMP reductase [Haemop protmod 86 .KVKKFESGIVSEPVTVLPNLTLAELAEMVKKNGFAGYPVVDEENNLIGIITGRD--------------------TRFVKDLSKTVSQVMTDLVTVKEGASREEILELMHQHRVEKVLVVNDSFKLKGMITVKDFQKA....... 205
126  7.000e-21 20  Rhodopseudomonas palustris CGA009 gi|39935269||ref|NP_947545.1| inosine monophosphate dehydrogenase [Rhodopseudomo protmod 91 ..VKKFESGMVVNPLTISPDAKLADALALMNQYGFSGIPVVTGAGKLVGILTNRDVRFATDP--------------------AQKVSELMTNLVTVREGVSQGEAKKLLHQHRIEKLLVVDDQYRCVGLITVKDMEKAVA..... 215
127  8.000e-21 25  Pyrococcus furiosus DSM 3638 gi|18976657||ref|NP_578014.1| inosine-5`-monophosphate dehydrogenase (imp dehydr protmod 91 .RVKRAERFIVEDVITIAPDETIDYALFLMEKHGIDGLPVVEED-RVVGIITKKDIAARE----------------------GRTVKELMTREVTVPESVDVEEALKIMMENRIDRLPVVNEDGKLVGLITMSDLV......... 203
128  8.000e-21 21  Bartonella quintana str. Toulouse gi|49473836||ref|YP_031878.1| Inosine-5-prime-monophosphate dehydrogenase [Barto protmod 91 ..VKKFESGMVVNPVTIGPDATLEEAKALMHSYGISGIPVVENAGRLVGILTNRDVRFASDPK--------------------QKIYELMTNLITVRENVQLDEAKYLLHHHRIEKLLVVDEQNRCVGLVTVKDIEKA....... 214
129  8.000e-21 19  Sinorhizobium meliloti 1021 gi|16263041||ref|NP_435834.1| hypothetical protein SMa1086 [Sinorhizobium melilo protmod 3 .....ARDIMKKRVLSISPDHSVSHAARAMLENQISGLPVCDDRGRLVGMLSEGDLLRRAELGLVSRRDIAGVRAEAFIKGHSWRVGDVMTQPVTVDEDMPVGRVAELMAAKGIKRIPVMRAE-EMVGIISRSDILRAV...... 138
130  8.000e-21 25  Bdellovibrio bacteriovorus HD100 gi|42523553||ref|NP_968933.1| similar to inosine-monophosphate dehydrogenase [Bd protmod 85 .KVKKYESGMIMDPITLGPDHLVEEAVALMEKYSISGVPVTV-NGELVGILTNRDLRF--------------------EENFNQPIRNLMTNLVTAKMGTTLDEAKKILQKHRIEKLPVVDSKGKLKGLITIKDIEKA....... 202
131  9.000e-21 19  Rhodopseudomonas palustris CGA009 gi|39934295||ref|NP_946571.1| CBS domain [Rhodopseudomonas palustris CGA009] gi| protmod 2 ....KAADVMTTAIVTVQPETPVHAIAETLLKHGISAVPVVDGAGVPLGIVSEGDLMPRADSDREARHDWWLQMLSEGEKSDTRTAKDVMVGPVTVEETTALADIADLLVEKRIKRVPVV-RAGHIVGIVSRADLLKTM...... 146
132  9.000e-21 19  Mesorhizobium loti MAFF303099 gi|13476895||ref|NP_108464.1| inosine monophosphate dehydrogenase [Mesorhizobium protmod 91 ..VKKFESGMVVNPVTIGPDATLADALSLMRTYSISGIPVVEKTGRLVGILTNRDVRFASDP--------------------AQKVYELMTNLITVKENVDQDEAKRLLHQHRIEKLVVVDKQGNCVGLITVKDIEK........ 214
133  9.000e-21 18  Sinorhizobium meliloti 1021 gi|15964513||ref|NP_384866.1| PROBABLE INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE PR protmod 91 ..VKKFESGMVVNPVTIGPDATLADALGLMKAHGISGIPVVENQGRLVGILTNRDVRFASDP--------------------SQKIYELMTNLITVKESVDQQEAKRLLHKHRIEKLLVVDPEGRCVGLITVKDIEK........ 214
134  1.000e-20 20  Burkholderia pseudomallei K96243 gi|53722035||ref|YP_111020.1| putative membrane protein [Burkholderia pseudomall protmod 254 ......AEIMSRRPISIAPDTPLPAAMTLLERHRIKALPVVDADARVVGIVTRADLSKAAPYATPGFLRNLSARLPRSLVGPAFVARAVMSRVHTVRTTTPIAELVPLFADHGHHHIPVVDADHQLAGIVTQADLIAGLYRQSQ. 392
135  1.000e-20 20  Bacillus clausii KSM-K16 gi|56964308||ref|YP_176039.1| hypothetical protein ABC2543 [Bacillus clausii KSM protmod 177 ....KIASVMSKPVITVQTSQLIDEVWQTLLRSGHSGFPVVDETGALAGVITRMDLAKARQFGM-----------------GEAQVTEVMSMPITLRANDSIDAACAHLAYNQVGRLPVVGDNNEPIGIVTRTDIVRSLYPNK.. 299
136  1.000e-20 19  Moorella thermoacetica ATCC 39073 gi|49235248||ref|ZP_00329320.1| COG0516: IMP dehydrogenase/GMP reductase [Moorel protmod 89 .RVKRLEHGVITDPISLSPDHKVREAIALMEHYHISGVPITD-NGKLVGIITNRDIRF--------------------EDNHERPIKEVMTNLVTAPVGTTLAEAMAILRAHKIEKLPLVDADYNLKGLITIKDIEKT....... 206
137  1.000e-20 15  Burkholderia cepacia R1808 gi|46323376||ref|ZP_00223741.1| COG3448: CBS-domain-containing membrane protein protmod 247 ....RCADLMTTHAIEVSPSTSVTAALTLLDRHRVKALPVVDGEARLIGIVTRADLTRPWRRPPPLWQRLSARLPQSFGGQPA-SVASVMTRDVACVPQTPITALVPLFTHSGHHHIPVVDASRRLVGIITQTDLVTGLYQQ... 384
138  1.000e-20 20  Legionella pneumophila str. Lens gi|54294611||ref|YP_127026.1| hypothetical protein lpl1687 [Legionella pneumophi protmod 86 .RVKKFESGMVKDPISVTPDLTVKELLAVMTKYNFSGVPVVDGK-HLVGIVTSRDIRFETN--------------------MNLTVAQVMTPKVTVKEGASREEVRSLLHKHRIEKLLVVNESFELRGLITVKDIQKA....... 204
139  1.000e-20 22  Haemophilus influenzae R2846 gi|42629674||ref|ZP_00155219.1| COG0516: IMP dehydrogenase/GMP reductase [Haemop protmod 86 .KVKKFESGIVSEPVTVLPNLTLAELAEMVKKNGFAGYPVVDEENNLIGIITGRD--------------------TRFVKDLSKTVSQVMTDLVTVKEGASREEILELMHQHRVEKVLVVNDSFKLKGMITVKDFQKA....... 205
140  1.000e-20 25  Archaeoglobus fulgidus DSM 4304 gi|11497944||ref|NP_069168.1| hypothetical protein AF0332 [Archaeoglobus fulgidu protmod 233 ....RVADVMNTEVVTVTPEMTVSEVIDLILKTKHLGFPVVEGE-RLVGIITLHDIIGVEPEER---------------------VGNIMSREVVVSPNQSAFEAFKIMSEMGIGRLPVV-EHGRVVGIVSRSDLMR........ 343
141  1.000e-20 22  Methanosarcina acetivorans C2A gi|20092371||ref|NP_618446.1| hypothetical protein MA3565 [Methanosarcina acetiv protmod 2 MKVK---DVMNPDVVFCKPDDTVREAAKLLKENNISGAPVL-EDGQLVGVVSEADLLELLVIPEKGNLWLPEETKKMLSDVGSTKVEEMMTKEVTISSEASVEEASELMVRHRINRLPVM-ENDRVVGIVTRGDIIEGLAK.... 154
142  1.000e-20 24  Methanocaldococcus jannaschii DSM 2661 gi|15669812||ref|NP_248626.1| inosine-5`-monophosphate dehydrogenase, (guaB) [Me protmod 89 ..VKKADEVVIKDVITVSPDDTVGEAINVMETYSISGLPVVDNEDKLVGIITHRDVKAIEDK--------------------TKKVKDVMTKDVVCAKDVEEEEALELMYANRVERLPIVDDENRLIGIITLRDILK........ 204
143  1.000e-20 19  Brucella melitensis 16M gi|17989241||ref|NP_541874.1| INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE [Brucella m protmod 93 ..VKKFESGMVVNPVTIGPDATLADAQALMKAHGISGIPVVENAGRLVGILTNRDVRFASDPK--------------------QKIYELMTNLITVHENVNQDEAKRLLHSHRIEKLLVVDDKDRCVGLVTVKDIEK........ 213
144  1.000e-20 22  Bacillus subtilis gi|39959||emb|CAA39204.1| IMP dehydrogenase [Bacillus subtilis] protmod 87 .KVKRSERGVITNPFFLTPDHQVFDAEHLMGKYRISGVPIVNEDQKLVGIITNRDLRFISDYSM--------------------KISDVMTKEVTASVGTTLDEAEKILQKHKIEKLPLVDDQNKLKGLITIKDIEKVI...... 208
145  1.000e-20 21  Mesorhizobium sp. BNC1 gi|45915273||ref|ZP_00193868.2| COG0516: IMP dehydrogenase/GMP reductase [Mesorh protmod 91 ..VKKFESGMVVNPVTIGPDATLADAHALMGAHRISGIPVVENGGKLVGILTNRDVRFASNP--------------------AQPVRELMTRLITVKESVSQEEAKRLLHQNRIEKLLVVDDAGNCVGLITVKDIEK........ 214
146  1.000e-20 16  Mesorhizobium sp. BNC1 gi|45682352||ref|ZP_00193788.1| COG0517: FOG: CBS domain [Mesorhizobium sp. BNC1 protmod 2 ....RVRDVMSTQLVTISPEHSVWHAAQIMLTKHVSGLPVLDDGQVMVGLLTEGDLLRRSELGTPLGDEGAQERARAYVQSRSWKVGALMSSPVTIGEDAPLSRVAMLLGVHRIKRLPVL-RDTQLVGIVSRADLLKVISAG... 139
147  1.000e-20 21  Clostridium acetobutylicum ATCC 824 gi|15895958||ref|NP_349307.1| IMP dehydrogenase [Clostridium acetobutylicum ATCC protmod 85 .RVKRQENGVITNPISLSKDNSVQEALDLMKRYRISGVPITDNAGKLIGIITNRDIVFETD--------------------YSKKIEELMTNLVTAPQGTTIDEAKNLLKKHKIEKLPLVDENFVLKGLITIKDIEK........ 202
148  1.000e-20 16  Geobacillus kaustophilus HTA426 gi|56419104||ref|YP_146422.1| inosine-5-monophosphate dehydrogenase [Geobacillus protmod 8 ....KVQDIMTKNVATISPNQTVQEAAQIMSQKNIGALPVV-ENGQVKGMITDRDI--------------TLRVSSQGKDPSTVKVAEVMTNVVTGTPNMSVQEAANVMAQHQVRRLPIV-ENNQLQGIVALGDI.......... 123
149  1.000e-20 19  Mesorhizobium sp. BNC1 gi|45915890||ref|ZP_00197260.1| COG0517: FOG: CBS domain [Mesorhizobium sp. BNC1 protmod 2 ....RAKDLMSTRCVTVSAENSIKHAAQIMLDHDLSGLPVLADDGRLVGIITEGDLLRRCELGNVGEELLPEKRARGYLHGHGWKVGHVMSPDVVVTEDASADHIAELMARHGIKRVPVLRGD-RVVGIVSRRDLLKLICSAPK. 143
150  1.000e-20 22  Actinobacillus pleuropneumoniae serovar 1 str. 4074 gi|46143710||ref|ZP_00134555.2| COG0516: IMP dehydrogenase/GMP reductase [Actino protmod 85 .KVKKFESGIVSEPVTVSPDLTLAELAELVKKNGFAGYPVVDSENNLIGIITGRD--------------------TRFVRDLTKTVAKVMTPKVTVKESANREEILELMHQHRVEKVLMVDDNFKLKGMITVKDFQKA....... 204
151  2.000e-20 22  Geobacillus kaustophilus HTA426 gi|56418544||ref|YP_145862.1| inositol-monophosphate dehydrogenase [Geobacillus protmod 87 .KVKRSERGVITDPFFLTPDHQVYDAEHLMSKYRISGVPIVNEEQKLVGIITNRDLRFI--------------------QDYSIKISEVMTNLITAPVGTTLEEAEKILQRHKVEKLPLVDENGVLKGLITIKDIEKVI...... 208
152  2.000e-20 26  Thermus thermophilus HB27 gi|46198785||ref|YP_004452.1| acetoin utilization acuB protein [Thermus thermoph protmod 3 .....VRDWMTKDPVVVAPDTPVLEAIRLLKEKGFRRLPVM-EGGRLVGLVTDKDLKDAMPSKATTLSVWEMNYLLA-----KLTVREVMARPVTVEADAPLEKAALLMEERKIGGLPVMEGE-RLVGIITVTDVLRAFIE.... 132
153  2.000e-20 25  Anaplasma marginale str. St. Maries gi|56416435||ref|YP_153509.1| inosine monophosphate dehydrogenase [Anaplasma mar protmod 86 .KVKKHESWIVSNPVTVSPDATLSTALSVMRKHSYSGIPVVTPQNKLVGILTNRDVRFVDNKNC--------------------KASDIMTNLVTVSEGISQSEATRLLHKHKIERLIVTDEHGCCIGLITVKDIER........ 204
154  2.000e-20 20  Enterococcus faecium gi|48824606||ref|ZP_00285959.1| COG0516: IMP dehydrogenase/GMP reductase [Entero protmod 89 .KVKRSESGVIIDPFFLTPQHLVADAEELMSKYRISGVPIVEENRKLVGIITNRDMRFVTDYHM--------------------PIADVMTNLVTAPVGTSLKDAEKILQKHKIEKLPIVDNEGRLSGLITIKDIEKVI...... 210
155  2.000e-20 20  Burkholderia mallei ATCC 23344 gi|53717049||ref|YP_105844.1| HPP family protein [Burkholderia mallei ATCC 23344 protmod 239 ......AEIMSRRPISIAPDTPLPAAMTLLERHRIKALPVVDADARVVGIVTRADLSKAAPYATPGFLRNLSARLPRSLVGPAFVARAVMSRVHTVRTTTPIAELVPLFADHGHHHIPVVDADHQLAGIVTQADLIAGLYRQSQ. 377
156  2.000e-20 24  Desulfitobacterium hafniense DCB-2 gi|53686059||ref|ZP_00099821.2| COG0517: FOG: CBS domain [Desulfitobacterium haf protmod 2 ....KVQDIMQTNVITISPNTEIREIAKLLCDHHISGVPVIDLFGNLIGIVSEGDLLHKETHPRVPEARGVKQYESDLKKLVALKASEIMTHEVTLEKDAAIEEAASLMINHNVKRLPIM-ENGKMVGIITRKDVIKVLIE.... 148
157  2.000e-20 22  Streptococcus thermophilus LMG 18311 gi|55821983||ref|YP_140425.1| inosine monophosphate dehydrogenase [Streptococcus protmod 89 .KVKRSENGVIIDPFFLTPEHKVSEAEELMERYHISGVPIVEENRKLVGIITNRDMRFISN--------------------YETPISEHMTSEVTAPVGTDLETAESILHEHRIEKLPLVDEEGRLSGLITIKDIEKVI...... 210
158  2.000e-20 19  Mannheimia succiniciproducens MBEL55E gi|52424829||ref|YP_087966.1| GuaB protein [Mannheimia succiniciproducens MBEL55 protmod 85 .KVKKFESGVVSEPVTVFPELSLGELAQLVKKNGFAGYPVIDQNDNLVGIITARD--------------------TRFVKDLNKTVAEVMTPKVTVKEGAKREDIIALMHSHRVEKVLVVDDNFKLKGMITVKDFQKA....... 204
159  2.000e-20 22  Haemophilus influenzae Rd KW20 gi|16272183||ref|NP_438392.1| inosine-5`-monophosphate dehydrogenase [Haemophilu protmod 86 .KVKKFESGIVSEPVTVLPNLTLAELAEMVKKNGFAGYPVVDGENNLIGIITGRD--------------------TRFVKDLSKTVSQVMTDLVTVKEGASREEILELMHQHRVEKVLVVNDSFKLKGMITVKDFQKA....... 205
160  2.000e-20 21  Haemophilus somnus 2336 gi|53728499||ref|ZP_00132545.2| COG0516: IMP dehydrogenase/GMP reductase [Haemop protmod 85 .KVKKFESGIVSEPVTVSPTMTLTELAELAKKNGFAGYPVVDEQKGLVGIITGRD--------------------TRFVSDLNKTVADFMTPKVTVKEGATREEIFHLMHEHRVEKVLVVDNSFKLKGMITLKDYQKAESK.... 207
161  2.000e-20 22  Streptococcus pneumoniae R6 gi|15904074||ref|NP_359624.1| Inosine-5`-monophosphate dehydrogenase [Streptococ protmod 89 .KVKRSENGVIIDPFFLTPEHTIAEADELMGRYRISGVPVVEENRKLVGILTNRDLRFISD--------------------YNQPISNHMTNLVTAPVGTDLATAESILQEHRIEKLPLVDEEGSLSGLITIKDIEKVI...... 210
162  2.000e-20 22  Streptococcus thermophilus CNRZ1066 gi|55823900||ref|YP_142341.1| inosine monophosphate dehydrogenase [Streptococcus protmod 89 .KVKRSENGVIIDPFFLTPEHKVSEAEELMERYHISGVPIVEENRKLVGIITNRDMRFISN--------------------YETPISEHMTSEVTAPVGTDLETAESILHEHRIEKLPLVDEEGRLSGLITIKDIEKVI...... 210
163  2.000e-20 26  Thermus thermophilus HB8 gi|55980798||ref|YP_144095.1| putative acetoin utilization protein, acetoin dehy protmod 3 .....VRDWMTKDPVVVAPDTPVLEAIRLLKEKGFRRLPVM-EGGRLVGLVTDKDLKDAMPSKATTLSVWEMNYLLA-----KLTVREVMARPVTVEADAPLEKAALLMEERKIGGLPVMEGE-RLVGIITVTDVLRAFIE.... 132
164  2.000e-20 24  Desulfovibrio desulfuricans G20 gi|53691219||ref|ZP_00130055.2| COG0517: FOG: CBS domain [Desulfovibrio desulfur protmod 1 .........MSRDVISATPEMSMMRAAKLMKEHSFDRLPIVDKDNKLVGIISDRDIKEASPSKATTLDVHELYYLLSEIK-----VNDIMTDVVAAKPDDTVENAALVMLERDFSGMPVVDDDGRLTGIITDKDIFKVL...... 126
165  3.000e-20 18  Rubrobacter xylanophilus DSM 9941 gi|46105700||ref|ZP_00199640.1| COG0517: FOG: CBS domain [Rubrobacter xylanophil protmod 6 ....RVRDSMTREVVTITPEASVAEAWELCRRHRIRHLPVV-EGGRLVGLVSDRDLRDASPPRSTGDEEHSFGWARM---------RDIMTELITIHPLDTIEHAAREIYERRIGCLPVV-EDGRLVGIITSSDMMRTLVE.... 132
166  3.000e-20 20  Streptococcus agalactiae NEM316 gi|25012153||ref|NP_736548.1| hypothetical protein gbs2118 [Streptococcus agalac protmod 89 .KVKRSENGVIIDPFFLTPDNTVSEAEELMQNYRISGVPIVEENRKLVGIITNRDMRFISDYKQLISEHMTSQ------------------NLVTAPIGTDLETAERILHEHRIEKLPLVDDEGRLSGLITIKDIEKVI...... 210
167  3.000e-20 23  Methanococcoides burtonii DSM 6242 gi|41718613||ref|ZP_00147592.1| COG0517: FOG: CBS domain [Methanococcoides burto protmod 3 .....VKDIMSSNVIVCSPQDTISSTAQLLKKKNISGVPVVDE-GKVVGIVSEVDLLKLLNIPPIRELIGWEDTKKMLSDVGSKPVSDIMEKDVTIGLESSVEDASRSMSRHKINRLPVVD-NGEIVGLITRGDIIRGLA..... 152
168  3.000e-20 28  Pyrococcus horikoshii OT3 gi|14590227||ref|NP_142293.1| inosine-5`-monophosphate dehydrogenase [Pyrococcus protmod 91 .RVKRAERLIVEDVITIAPDETVDFALFLMEKHGIDGLPVVEDE-KVVGIITKKDIAARE----------------------GKLVKELMTKEVTVPESIEVEEALKIMIENRIDRLPVVDERGKLVGLITMSDLV......... 203
169  3.000e-20 30  Desulfovibrio desulfuricans G20 gi|53690831||ref|ZP_00346477.1| COG0517: FOG: CBS domain [Desulfovibrio desulfur protmod 1 .........MSADPVTVAPDMDIIEATKLMLEYKFNGLPVVDDAGKLVGVLCQSDLVAQTILDGFIPLKSLSDMDSEMRKVAATRVSDAMTDPATVTPDTPLDEVATLMVDSKYYTLPVV-KDGILVGVVGKEDVLRTL...... 140
170  3.000e-20 18  Prochlorococcus marinus str. MIT 9313 gi|33862790||ref|NP_894350.1| similar to IMP dehydrogenase [Prochlorococcus mari protmod 1 .........MSTPVLSVVPATSLQEAVQLLSDHHISGLPVVNDDGTLVGELTEQDLMYVLLLDSVIYLRNPLNWDKQVHQVLGTSVNDLMSDTHTCNEALPLPRAAAMLHDRSTQRLFVINDQRKLVGVITRGDVVRALS..... 142
171  4.000e-20 19  uncultured archaeon GZfos12E1 gi|52632001||gb|AAU85401.1| inosine-5`-monophosphate dehydrogenase [uncultured a protmod 34 MK-KKVEEIMTKEVITAKENDSLLDVATVLKENKIAGVPVLNEREEVVGVISEADVLKLLHDLMNIFGEDLHDVQQDIEKASKMKVKDVMSKPETVPPDTLIDDAAQIMHSTGFNRLPVVDENDKLVGIVARADIIASLYE.... 186
172  4.000e-20 18  Clostridium tetani E88 gi|28210105||ref|NP_781049.1| inosine-5-monophosphate dehydrogenase related prot protmod 2 ....KINNIMTKDIVSLQAEDTVEHAAQLMKEHGVGSLPICNE-GKIVGIITDRDI--------------ALRSVAMGESIQNQTVRNIMTNPITVSPNISATEAAEIMSKKQIRRLPVV-ENKNLVGMVSLGDI.......... 117
173  4.000e-20 18  Magnetococcus sp. MC-1 gi|48832691||ref|ZP_00289721.1| COG0517: FOG: CBS domain [Magnetococcus sp. MC-1 protmod 2 ....RVKDVMTTHVRTARRHDDLKSVASQICALKVSGLPVVEEGGRLVGIVSEKDILNALLPSYSDYLADPEAMEATYPEVMGRSVEEVMIASVTCNPEDPVLDAASRMTSRHFRRLPVVDDKQLLVGIVSLSDIHQAIFK.... 145
174  4.000e-20 19  Leifsonia xyli subsp. xyli str. CTCB07 gi|50955518||ref|YP_062806.1| inosine-5`-monophosphate dehydrogenase [Leifsonia protmod 88 .KVKRSESGMITNPVTITPEATVEEVDQLCGQFRVSGLPVVEGDGTLVGIVTNRDMRFVSPSERATAL-----------------VREVMTPLITAPVGIDPDAAVAIFAERKIEKLPLVDADGKLRGLITVKD........... 205
175  4.000e-20 22  Chloroflexus aurantiacus gi|53795190||ref|ZP_00356283.1| COG0517: FOG: CBS domain [Chloroflexus aurantiac protmod 204 ....RAADVMTPNPTTIPATASLTQAALLMTEHDHKRLPVVDEAGRLVGMLSRSDLLQTVANTFASSSEVLPGSILT----TAKTVGEVMRDVPTVTPETPLAETLDRILSTPRRRVVVVDQNRRVVGIISDGDILRRAAR.... 337
176  5.000e-20 22  Streptococcus mutans UA159 gi|24378516||gb|AAN59746.1| inosine monophosphate dehydrogenase [Streptococcus m protmod 89 .KVKRSENGVIIDPFFLTPEHKVSEAEELMQRYRISGVPVVEDNRKLIGIITNRDMRFISD--------------------YETPISEHMTSEVTAPVGTDLETAERILHEHRIEKLPLIDEKGRLSGLITIKDIEKVI...... 210
177  5.000e-20 23  Acidianus ambivalens gi|40783||emb|CAA45529.1| unnamed protein product [Acidianus ambivalens] gi|9924 protmod 4 ....KVSQIATTKVYVVKPNVTIAEAAKEMKEHNLGSLVVIDSQNRVVGIITERDIVKAAS---------NRDIDSPVEKYMTKDVKG-------VTEDTEVTDALDIMLNNGFRHLPIIKSNGKLYGIVSIRDLARAL...... 122
178  5.000e-20 18  Gallus gallus gi|50732233||ref|XP_418540.1| PREDICTED: similar to AMP-activated protein kinase protmod 1610 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSMLETLETIVDRIVKAEVHRLVVVNEADSIVGIISLSDILQAL......1730
179  5.000e-20 22  Bacillus subtilis subsp. subtilis str. 168 gi|16077077||ref|NP_387890.1| inosine-monophosphate dehydrogenase [Bacillus subt protmod 87 .KVKRSERGVITNPFFLTPDHQVFDAEHLMGKYRISGVPIVNEDQKLVGIITNRDLRFISDYSM--------------------KISDVMTKEVTASVGTTLDEAEKILQKHKIEKLPLVDDQNKLKGLITIKDIEKVI...... 208
180  6.000e-20 21  Staphylococcus epidermidis ATCC 12228 gi|27469266||ref|NP_765903.1| inositol-monophosphate dehydrogenase [Staphylococc protmod 87 .KVKRSENGVISNPFFLTPEESVYEAEALMGKYRISGVPIVDEDRKLIGILTNRDLRFIEDFSI--------------------KISDVMTNLITAPVGTTLDEAEAILQKHKIEKLPLV-ENGRLEGLITIKDIEKVL...... 207
181  6.000e-20 18  Gluconobacter oxydans 621H gi|58040690||ref|YP_192654.1| Inosine-5`-monophosphate dehydrogenase [Gluconobac protmod 94 .RVKRFESGMVVNPVTVGPDQTLAEVQAIMARHGVSGLPVIDGSGVLVGILTNRDMRFTTDP--------------------NTRVRDLMTNLVTVLNGAAPDEARTLLHRHRIEKLLVVDEAKRCIGLITVKDMDKAIA..... 215
182  8.000e-20 20  Helicobacter hepaticus ATCC 51449 gi|32262251||gb|AAP77299.1| Inosinic acid dehydrogenase GuaB [Helicobacter hepat protmod 84 .RVKKSESGVIIDPIYIRANNTLADAKSITDNYKISGVPVVDEYGKLIGILTNRDMRF--------------------EQDLSKYVGDLMTKLVTAKVGTTLEEAKEIMHKNRIEKLPIVDENYMLKGLITIKDIQKRI...... 203
183  8.000e-20 20  Mesorhizobium loti MAFF303099 gi|13475518||ref|NP_107082.1| hypothetical protein mll6611 [Mesorhizobium loti M protmod 3 .....AEAIMSKPVVGIDPSASIAEAAGLMLSKKVSGLPVIRNDGRLVGIVSEGDFLRRKRSRWLEFLVTPGRAADEYVRANGRRVEEVMSDVVTASPAASLAKVVELMTRRHVKRIP-ATEGGKVVGIITRSDLLRAL...... 143
184  8.000e-20 25  Symbiobacterium thermophilum IAM 14863 gi|51894052||ref|YP_076743.1| inosine-5`-monophosphate dehydrogenase [Symbiobact protmod 86 .KVKRSEHGIIVDPVFVHPDDMIETALQLMARYRISGTPVVERTHKLVGILTNRDLRF--------------------EDNWNQPVGNVMTNLITAPVGTTLEQAREILRHAKVEKLPLVDEHGVLKGLITIKDIEKA....... 205
185  8.000e-20 26  Methanopyrus kandleri AV19 gi|20094305||ref|NP_614152.1| CBS-domain-containing protein [Methanopyrus kandle protmod 11 ....KVEELMTKDPITASPQVGVIEAFEIMLKHDVGALPVVDDEGRLIGLVTRTDLGRALLEDEYE---------------PGTTVEEVMRDVVVVHPDDTLLEALKRMTSAPYNQLPVVDDEEKLVGILTDGDILRWIAK.... 136
186  8.000e-20 16  Campylobacter lari RM2100 gi|57018913||gb|EAL55686.1| inosine-5`-monophosphate dehydrogenase [Campylobacte protmod 84 .RVKKSESGVIIDPIYIGAKASVKEALELMAEYRISGVPVVDENKTLIGILTNRDLRFETNFDNL--------------------VENVMTPLITAKKGSTLDDAERIFSTNKVEKLPIVDENNHLEGLITIKDLKK........ 201
187  8.000e-20 18  Bradyrhizobium japonicum USDA 110 gi|27379749||ref|NP_771278.1| hypothetical protein blr4638 [Bradyrhizobium japon protmod 6 ........VMTRDVVAVTPHTTIEEAAKIMLRMHISGLPVIDDAGNLVGIVSESDFLRRSHAAWLKFFMGPRRAAAEFVHESGRKVEDVMTRVVSAREETSLVDVVDLMEKHDIKRVPVMRGE-ATIGIVTRSNLLQAMA..... 144
188  9.000e-20 24  Methanosarcina acetivorans C2A gi|20091538||ref|NP_617613.1| homoserine O-acetyltransferase [Methanosarcina ace protmod 421 .....VSDVMNRNFYTVSRDETIEHSSKLMVKECVSHLPVISEDGKLEGIVTSWDITKAVACKINELDEI------------------ITRDVKYVYEDEKIEHASSIMEKHSISALPVIDSEHRIIGIVTSESI.......... 532
189  9.000e-20 24  Archaeoglobus fulgidus DSM 4304 gi|11499010||ref|NP_070244.1| chloride channel, putative [Archaeoglobus fulgidus protmod 455 LENVRVQDAMVSKLVVVTPYQRVSEVLELIEKTGHMGFPVVM-DGRLVGMVTFEDVERVPLEERD-----------------KKLVRDIMTRELIVTPDETLEEALIKLVDKGIGRLPVVDDEKKLLGIITRSDIMKAHAREVKR 586
190  9.000e-20 24  Shewanella oneidensis MR-1 gi|24374804||ref|NP_718847.1| inosine-5`-monophosphate dehydrogenase [Shewanella protmod 85 .KVKIYEAGVVQQPVTVTPSTTLADLKVLTAKNGFAGYPVVNDANELIGIITGRDVRFVTD--------------------WSKTVEEVMTPKVTVAEGTKLDEVQKLMHSHRIEKVLVVDDNFKLKGLITVKDFEKA....... 204
191  1.000e-19 16  Azoarcus sp. EbN1 gi|56479232||ref|YP_160821.1| inosine-5`-monophosphate dehydrogenase [Azoarcus s protmod 84 .KVKRFESGVLKDPITIPPTMSVRDVMALTRLHKFSGLPVV-ENKRVVGIVTNRDVRFETN--------------------LDQPVAAIMTPFVTVKEGDSLEEARRLMHKHRLERVLVLNDAAELRGLITVKDMMK........ 201
192  1.000e-19 16  Halobacterium salinarum NRC-1 gi|15790525||ref|NP_280349.1| Clc [Halobacterium salinarum NRC-1] gi|10581031|gb protmod 639 .....AKDVMSTDVDTVTVGTSAMDALRVFQQRSHRGLPIVDADDTVAGMLVRSDVEPLVTVAGDT-AETVAVCARDGGQSPSTAVEELTTNVVTATPDTNLLTLVDRMARVDIGRIPIVDTDGSLVGIVTRTDVLAA....... 771
193  1.000e-19 24  Pyrococcus abyssi gi|5459077||emb|CAB50563.1| guaB inosine-5`-monophosphate dehydrogenase (EC 1.1. protmod 91 .RVKKAERFIVEDVITISPEETVDFALFLMEKHDIDGLPVV-ENEKVVGIISKKDIAARE----------------------GKLVKELMTDVITVPENIEVEEALKIMIENRIDRLPVVDKEGRLIGLITMSDLV......... 203
194  1.000e-19 20  Chloroflexus aurantiacus gi|53795190||ref|ZP_00356283.1| COG0517: FOG: CBS domain [Chloroflexus aurantiac protmod 119 ....RVADVMNHDVISVTSETSVGELVRLLLERGLRAMPVVDAERRVIGIVTDADLLQRGVSQLPLHLQQLLPGAERAVAARPERAADVMTNPTTIPATASLTQAALLMTEHDHKRLPVVDEAGRLVGMLSRSDLLQTVA..... 260
195  1.000e-19 17  Thermotoga maritima MSB8 gi|15644106||ref|NP_229155.1| inosine-5-monophosphate dehydrogenase-related prot protmod 17 ....RVSEFMNPDVIYVTPDKTLLHVKEIMRIKRISGVPVVDDKKRVVGIVSLEDIIKALEGSYI-----------------KDSVEKRMTKNVVCKETDTLQDAVKTFEKYGYGRFPVVDDEGKLVGIVTKHDII......... 132
196  1.000e-19 24  Gloeobacter violaceus PCC 7421 gi|37523751||ref|NP_927128.1| probable chloride channel protein [Gloeobacter vio protmod 444 .....AGDVMQTRLETLESTLPLSEVSQAFSRSHHRGFPVVKDE-KLVGIVTQTDLMKIAARNLPPTA----------------PLSELMTPPVTVTPRDSLKEVLYLLNRYELSRLPVVEEA-KLVGIITRSDIIRA....... 559
197  1.000e-19 21  Enterococcus faecalis V583 gi|29377734||ref|NP_816888.1| inosine-5`-monophosphate dehydrogenase [Enterococc protmod 89 .KVKRSESGVIIDPFFLTPTNLVADAEELMSRYRISGVPIVEENRKLVGIITNRDMRFVTDYQI--------------------KIEEVMTKLVTAPVGTSLKDAEKILQKHKIEKLPIVDEAGRLSGLITIKDIEKVI...... 210
198  1.000e-19 18  Shewanella oneidensis MR-1 gi|24374385||ref|NP_718428.1| CBS domain protein [Shewanella oneidensis MR-1] gi protmod 151 ....RISTLMSSSPITIDAHATVTQAALLMRNSRVSSLLVTD-NHKLVGILTDKDLRNRVLASGL-------DGQIAVHQAMT-------TSPISISSNALIFEAMLLMSEHNIHHLPIIDEQNKAIGMVTSTDILR........ 272
199  1.000e-19 22  Ralstonia solanacearum gi|17428444||emb|CAD15131.1| PROBABLE INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE OXI protmod 84 .KVKRFESGVLRDPITIGPDMKVRDVMALSAQHGISGFPVL-EGNKVVGIITNRDLRF--------------------EEELDAPVRAKMTPLVTVREGASLEEAKRLMNKHRLERVLVVDGNFELRGLITVKDIQKA....... 202
200  1.000e-19 22  Rubrobacter xylanophilus DSM 9941 gi|45545574||ref|ZP_00185717.1| COG0517: FOG: CBS domain [Rubrobacter xylanophil protmod 4 .....VEDSMTREVVTVSPETRADEALALCRERRIRHLPVL-EDGRLVGVVSDRDLRSATPALGDP---------ARAAALRRLRVGEVMSRVVTVRPDEPIEVAANRMREKGIGCLPVV-EDGRLAGIITTSDVMETL...... 127
201  1.000e-19 21  uncultured archaeon GZfos26B2 gi|52549167||gb|AAU83016.1| conserved hypothetical protein [uncultured archaeon protmod 377 .....VRDAMSEDVRTISVHAEIKEAAELIIEGKFNHLPVLSEDGALVGIVTSWDISKAVARGDTG------------------TVRSAMTRVVTSSPDEFVEIAVRKMERHKISALPVIDPNRKVIGMVTSGDLNKLLVR.... 495
202  1.000e-19 19  Methylobacillus flagellatus KT gi|46121018||ref|ZP_00173857.2| COG0516: IMP dehydrogenase/GMP reductase [Methyl protmod 84 .RVKRFESGVVHDPVTIQPNLTVRDVLALTRQHKISGLPVVDGK-KVVGIVTNRDLRFETN--------------------LDQAISNIMTPLVTVREGASLEEATALLHKHRLERVLVVNDAFELKGLITVKDIQK........ 201
203  1.000e-19 21  Haemophilus ducreyi 35000HP gi|33148780||gb|AAP96298.1| inosine-5`-monophosphate dehydrogenase; IMP dehydrog protmod 85 .KVKKFESGIVSEPVTVSPELTLAELAQLVKKNGFAGYPVVDNENNLVGIITGRD--------------------TRFVQDLTQTVSKVMTRLVTVKENAKREEILALMHEHRVEKVLMVDDAFKLKGMITVKDFQKA....... 204
204  2.000e-19 23  Wolbachia endosymbiont of Drosophila melanogaster gi|42519998||ref|NP_965913.1| inosine-5`-monophosphate dehydrogenase [Wolbachia protmod 81 .RVKKYESWIVYNPITISQDKTVAEAISLMREHNYSGIPVVD-QRKLVGILTNRDMRFIEDQN------------------MNVKVSEVMTKLVTVREGVNSASAMKLLHENRIEKLLVVDENSCCIGLITVKDIEK........ 200
205  2.000e-19 24  Methanosarcina barkeri str. fusaro gi|48838897||ref|ZP_00295834.1| COG0517: FOG: CBS domain [Methanosarcina barkeri protmod 1 MKVK---DVMNPNVVFCKPDDTVRETARILKENNVSGAPVLEGE-ELVGIISEADLLKLLILPEKGELWLPEETKKMLSDVGSTKIEEIMRNVHTISSEASIEEASEHMIRHRINRLPV-TEDNRVVGIITRGDIIKGLAK.... 153
206  2.000e-19 25  Sulfolobus solfataricus P2 gi|15899929||ref|NP_344534.1| hypothetical protein SSO3230 [Sulfolobus solfatari protmod 28 MKEEFVKEYMKTRVITVGRNTMLKEVTRIMTDNNVGSVIVVD-NGKPIGIITERDVVRAIGK----------------GKSLDTIAEEIMTSLITIKEDSPITGALSLMRTYNIRHLPVIDYDGNLRGIISIRDIARAI...... 150
207  2.000e-19 20  Bacillus cereus gi|11251771||pir||JC7305 IMP dehydrogenase (EC 1.1.1.205) - Bacillus cereus gi|6 protmod 87 .KVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNDERKLVGIITNRDMRFI--------------------QDYSIKISDVMTKEITAPVGTTLEEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVI...... 208
208  2.000e-19 17  Streptomyces coelicolor A3(2) gi|5748631||emb|CAB53136.1| conserved hypothetical protein SCJ1.18 [Streptomyces protmod 1 .........MTHTAVAVGPEAPFKDIIALLDQWKVSALPVLEGEGRVIGLVSEADLPKEEFRDSDPDRFTQMRRLTDLAKAGGLTAADVMTAPVTVHPDATLAQAARIMAQRKVKRLPVVNAEGLLEGVVSRADLLKVFLR.... 134
209  2.000e-19 24  Methanothermobacter thermautotrophicus str. Delta H gi|15678170||ref|NP_275285.1| inosine-5`-monophosphate dehydrogenase [Methanothe protmod 89 .KVKRSGDITIRDVITISPDSTLREAHEIMDQEEISGLPVV-EDGVLIGIISRRDIEPIFNSDAD------------------KKVDQVMTDVVTVDESITPNEALDIAYENKVERLPVV-KDGRIVGMLTMKDILE........ 205
210  2.000e-19 20  Agrobacterium tumefaciens str. C58 gi|17934534||ref|NP_531324.1| inosine-5`-monophosphate dehydrogenase [Agrobacter protmod 63 ..VKKFESGMVVNPVTIGPDATLAEAQALMKAHGISGIPVVEKNGRLVGILTNRDVRFASDPQ--------------------QKIYELMTNLVTVKESSDQQEARRLLHKHRIEKLLVVDGKGNCVGLITVKDIEK........ 187
211  2.000e-19 20  Photorhabdus luminescens subsp. laumondii TTO1 gi|37526603||ref|NP_929947.1| inosine-5`-monophosphate dehydrogenase (IMP dehydr protmod 85 .RVKKHESGVVTDPVTVAPETTLREVKELTERNGFAGYPVVTEGNELVGIITGRDVRFVTD--------------------LDQPVTAVMTPKVTVKEGEAREVVLQKMHEKRVEKALVVDENFHLLGMITVKDFQKA....... 204
212  2.000e-19 18  Methanosarcina mazei Go1 gi|21226343||ref|NP_632265.1| hypothetical protein MM0241 [Methanosarcina mazei protmod 380 .....VKDVMSDFIVTIKKDQTVQDAAKKIWENSFNHLAVVSDTGELVGILTAWDISKAVAENIF------------------DSVESVMTKKVTCAPNEPVDLAARRLDRYGVSAMPVIDAQKKVLGIITSDNISKLFAR.... 498
213  2.000e-19 17  Mus musculus gi|21703802||ref|NP_663376.1| protein kinase, AMP-activated, gamma 2 non-catalyt protmod 431 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 562
214  2.000e-19 20  Clostridium tetani E88 gi|28211998||ref|NP_782942.1| inosine-5-monophosphate dehydrogenase [Clostridium protmod 85 .RVKRQENGVITDPFHLSPDKKLQDALDLMSKYRISGVPITVE-GKLVGIITNRDIVF--------------------EDDYSKKISELMTDEITAPENTTIDQAREILKKHKIEKLPLVDENFNLKGLITIKDI.......... 199
215  2.000e-19 20  Haemophilus influenzae R2866 gi|42630524||ref|ZP_00156063.1| COG0516: IMP dehydrogenase/GMP reductase [Haemop protmod 86 .KVKKFESGIVSEPVTVSPDLSLAKLAELVKKNGFAGYPVVDSENNLIGIITGRD--------------------TRFVKDLSKTVSQVMTKKVTVKEGATREEILALMHQHRVEKVLMVNDSFKLKGMITVKDFQKA....... 205
216  2.000e-19 17  Ralstonia metallidurans CH34 gi|48771215||ref|ZP_00275558.1| COG3448: CBS-domain-containing membrane protein protmod 225 ....RCSDIMSRDVVAVRPGQRAADAAALLARHHIKALPVVDGNRRLLGIVTQSDFFRA---------------HRSNSRRVNGTVRDLMTRVVTAHVDQPMVELAHAFSDGGLHHVPVVDGDRHVVGMVTQSDLVAALLR.... 347
217  2.000e-19 21  Geobacter metallireducens GS-15 gi|48846871||ref|ZP_00301130.1| COG0516: IMP dehydrogenase/GMP reductase [Geobac protmod 86 .KVKKSESGMIVDPITMRPNQKIHEALAIMEKYRISGVPVTNAKGKLVGILTNRDLRFETD--------------------LNLPISARMTKKVTVAVGTTLEEAKEHLKQTRVEKLLVVDDDKNLKGLITIKDIEK........ 203
218  2.000e-19 20  Bacillus cereus ATCC 14579 gi|30018286||ref|NP_829917.1| Inosine-5`-monophosphate dehydrogenase [Bacillus c protmod 87 .KVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNDERKLVGIITNRDMRFI--------------------QDYSIKISDVMTKEITAPVGTTLEEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVI...... 208
219  3.000e-19 18  Helicobacter pylori J99 gi|12230202||sp|Q9ZL14|IMDH_HELPJ Inosine-5`-monophosphate dehydrogenase (IMP de protmod 84 .KVKKSESGVINDPIFIHAHRTLADAKVITDNYKISGVPVVDDKGLLIGILTNRDVRFETD--------------------LSKKVGDVMTPLVTAHVGISLDEASDLMHKHKIEKLPIVDKDNVLKGLITIKDIQKRI...... 203
220  3.000e-19 20  Clostridium thermocellum ATCC 27405 gi|48858531||ref|ZP_00312483.1| COG0617: tRNA nucleotidyltransferase/poly(A) pol protmod 310 ..VERAKDIMSSPVKTISLDSTIDEANKIMLRYGHSGLPVV-KDGILCGIISRRDVEKAR-----------------IHGFGNSPVKAYMTNVITIDPETPLKTIENLLVEHNIGRLPVVAGN-KLLGIVTRSDVISTL...... 428
221  3.000e-19 28  Aquifex aeolicus VF5 gi|15606685||ref|NP_214065.1| polysialic acid capsule expression protein [Aquife protmod 195 .KLRLVKDLYHTEVPIVKEDTSMKEAIIEMTAKGFGATAVVNEEGKLVGIITDGDLRRFV---------------NRGGSFENTRAKDVMTNPKTIKPDELALKALRKMEDHNITVLIVVNEENEPIGILHMHDILKA....... 319
222  3.000e-19 18  Polaromonas sp. JS666 gi|54031129||ref|ZP_00363264.1| COG2905: Predicted signal-transduction protein c protmod 21 ......SQIARREPVTVTLDTPLGEALAIMDRMRIGSIIVVDAQGQMLGIFTLRDLLHRVTLPQVN---------------LDQPIASVMTGVITVKPHTTAYEAPLIMARRGLRHLLMVDEAGHLVSIVSQNDL.......... 136
223  3.000e-19 18  Helicobacter pylori 26695 gi|2313963||gb|AAD07879.1| inosine-5`-monophosphate dehydrogenase (guaB) [Helico protmod 84 .KVKKSESGVINDPIFIHAHRTLADAKVITDNYKISGVPVVDDKGLLIGILTNRDVRFETD--------------------LSKKVGDVMTPLVTAHVGISLDEASDLMHKHKIEKLPIVDKDNVLKGLITIKDIQKRI...... 203
224  3.000e-19 21  Chloroflexus aurantiacus gi|53796794||ref|ZP_00357711.1| COG0517: FOG: CBS domain [Chloroflexus aurantiac protmod 2 ....KAREIMTKNVVCVTDDAAVEDAARLMTRNRISGLPVVNPQGMLVGLVTEHDLIAKE----------------------GRTVKEIMTSVISVSPDTEVEQIQHLLTNQRIRRVPVV-ENGKVVGIVSRSDLVRQIA..... 115
225  3.000e-19 17  Chromobacterium violaceum ATCC 12472 gi|34102613||gb|AAQ58978.1| inosine-5`-monophosphate dehydrogenase [Chromobacter protmod 84 .KVKRHESGVVKDPITIAPDMLVRDLVLLTRQYKISGLPVI-EAGKVVGIVTNRDLRFETR--------------------LDQTVGSIMTPLITVKEGASIDEARELMHTHRLERVLVINDAWELKGLITVKDIIKT....... 202
226  3.000e-19 23  Sulfolobus solfataricus P2 gi|15899877||ref|NP_344482.1| hypothetical protein SSO3174 [Sulfolobus solfatari protmod 3 .....VADLITRNPLTVKPETSIRDAAKIMKRENLGSLIIVDETNKPIGIVTERDILRAVADEV----------------ALDSPVSTIMTRLITIPPNKDVTEALIIMYQNNVRHLAVVGQSGELVGVISIRDAAKAV...... 121
227  3.000e-19 20  Sulfolobus solfataricus P2 gi|58419100||gb|AAW71115.1| IMP dehydrogenase, GuaB [Wolbachia endosymbiont stra protmod 84 .RVKKYENWIVYNPITISPDKTVAEAISLMKKHDYSGIPVVD-QRKLVGVLTNRDIRFIEDQN------------------MSIKVSEVMTKEVTIREQEDSASAMKLLHENRIEKLLVIDENFCCIGLITVKDIEK........ 203
228  3.000e-19 24  Anabaena variabilis ATCC 29413 gi|45508224||ref|ZP_00160564.1| COG0038: Chloride channel protein EriC [Anabaena protmod 438 ....TAKDVMQQRVETLDADITLEEAKQAFASSHHRGFPVV-EDNKLVGIITQSDLTKSLSRNLENHPH----------------LREIMTNPMTVTPIHTLSNVLYLLDRYQISRLPVVDGQ-KLIGIITRADIIR........ 553
229  3.000e-19 23  Desulfotalea psychrophila LSv54 gi|51244754||ref|YP_064638.1| probable inosine-5`-monophosphate dehydrogenase [D protmod 86 .KVKKSESGMIIDPVTVDLHQSVGEVQKIMSSYKISGLPVL-KDGKLVGIVTNRDLRFVSDNDL--------------------RVSEVMTNLVTAQVGITLEQSKALLHEHRIEKLLVVDDDGALNGLITIKDLEK........ 202
230  3.000e-19 20  Gloeobacter violaceus PCC 7421 gi|37521022||ref|NP_924399.1| probable poly A polymerase [Gloeobacter violaceus protmod 28 .....ARDVMSAPVRTLRPEIALMAARQRLTRYGHGAMPVVNAQGGLMGIISRRDLDIAL-----------------YHGFAEDPVERFMTTVLTVPSDAPLDEIEALMVTYDIGRVPVL-EAGQLVGIITRTDLLR........ 142
231  4.000e-19 20  Agrobacterium tumefaciens str. C58 gi|15155569||gb|AAK86431.1| AGR_C_1108p [Agrobacterium tumefaciens str. C58] gi| protmod 93 ..VKKFESGMVVNPVTIGPDATLAEAQALMKAHGISGIPVVEKNGRLVGILTNRDVRFASDPQ--------------------QKIYELMTNLVTVKESSDQQEARRLLHKHRIEKLLVVDGKGNCVGLITVKDIEK........ 217
232  4.000e-19 17  Pan troglodytes gi|55629882||ref|XP_519512.1| PREDICTED: similar to 5-AMP-activated protein kina protmod 1656 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQAL......1776
233  4.000e-19 16  Chloroflexus aurantiacus gi|53798090||ref|ZP_00358706.1| COG2905: Predicted signal-transduction protein c protmod 150 ....RLRDLVARPPVSISPEATVGDAARLMRDERISSLIV---EHTPIGIITDRDLRNRVLAEGLP---------------DTTPVRQVMSAPATIAADALAFEGLLLMLERGIHHLPLVEGD-RVVGVVTHTDILR........ 264
234  4.000e-19 19  Wolinella succinogenes DSM 1740 gi|34558190||ref|NP_908005.1| INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE [Wolinella protmod 84 .KVKKSESGVIIDPIYISPENTLAQAKALTDNYKISGVPVVDKEGILIGILTNRDVRFETDLSRL--------------------VGEVMTKAPLIKVGTSLEEAREIMHQHKIEKLPIVNEKGILKGLITIKDIQKRI...... 203
235  4.000e-19 19  Bacillus anthracis str. `Ames Ancestor` gi|47525264||ref|YP_016613.1| inosine-5`-monophosphate dehydrogenase [Bacillus a protmod 87 .KVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNDERKLVGIITNRDMRFI--------------------QDYSIKISDVMTKEITAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVI...... 208
236  4.000e-19 17  Thermobifida fusca gi|48835781||ref|ZP_00292779.1| COG0517: FOG: CBS domain [Thermobifida fusca] protmod 4 ....TVGDLMTTHVVAAFEEAGFKRLAVSLRMNGVSALPVLDADQRVVGVVSESDLLAWLAAPNLDEAVFAGDMPEEPV------ARDLMSTPITITEGASPREAAERMRRHRIKRLPVVTEDGKLLGIVSRSDLLR........ 131
237  4.000e-19 19  Bacillus thuringiensis serovar konkukian str. 97-27 gi|49476689||ref|YP_034368.1| IMP dehydrogenase (inositol-monophosphate dehydrog protmod 87 .KVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNDERKLVGIITNRDMRFI--------------------QDYSIKISDVMTKEITAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVI...... 208
238  4.000e-19 20  Nitrosomonas europaea ATCC 19718 gi|30248126||ref|NP_840196.1| guaB; inosine-5`-monophosphate dehydrogenase oxido protmod 85 ..VKRFESGVVTDPIIVSPDMTVRKVLELIRQHNISGLPVV-KSKKVVGIVTNRDLRFETN--------------------LDQPVKNIMTPKVTVREGVSKEDALALLHKHRLEKALIVSENFELRGMITVKDITRT....... 202
239  4.000e-19 19  Bacillus cereus ZK gi|52145201||ref|YP_081627.1| IMP dehydrogenase (inositol-monophosphate dehydrog protmod 87 .KVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNDERKLVGIITNRDMRFI--------------------QDYSIKISDVMTKEITAPVGTTLDEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVI...... 208
240  4.000e-19 20  Thermus thermophilus HB8 gi|55980786||ref|YP_144083.1| CBS domain protein [Thermus thermophilus HB8] gi|5 protmod 138 ...RPVGELVQRPPVFVDPTASVEEAARRMREEGISSLLV---RGEPLGILTDRDLRNRVLAEGLP---------------PSTPVGQVATRPFTLPADTPLLEAVAAMLERRIHHLPLTRGE-EVVGVVTHTDLLAHQAQ.... 257
241  4.000e-19 23  Aeropyrum pernix K1 gi|14602096||ref|NP_148644.1| hypothetical protein APE2489 [Aeropyrum pernix K1] protmod 16 ....RASDIMITEVVTVKPDDPVTRAAKLMVENLIGSVLVVDDEGRLRGIVTERDIVYVVSEAWDPTKH---------------RVWEIMTNPIVVRPDDDLLTVVRKMSETNVRHLPVVDEKGAPVGIISFRDVLDFL...... 136
242  4.000e-19 20  Bacillus halodurans gi|7007417||dbj|BAA90835.1| GuaB [Bacillus halodurans] protmod 87 .RVKRSESGVITNPFFLTPDRQVFDAEHLMGKYRISGVPIVDEDQKLVGILTNRDLRFI--------------------EDYSTLIDDVMTNLVTAPVGTTLKEAEEILQKHKIEKLPLVDESGTLKGLITIKDIEKVI...... 206
243  4.000e-19 18  Thiobacillus denitrificans ATCC 25259 gi|52007747||ref|ZP_00335124.1| COG0516: IMP dehydrogenase/GMP reductase [Thioba protmod 85 ..VKRFESGVVKDPITVAPQMTVRQVLEITRAKRISGLPVI-EDGRVVGIVTNRDLRFESR--------------------LDQPVSAIMTPKVTVKEGANRDEAMALLHKHRLERVLVVNDDFELRGLITVKDIQK........ 201
244  4.000e-19 19  Bacillus cereus gi|6705995||dbj|BAA89464.1| IMPDH [Bacillus cereus] protmod 87 .KVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNDERKLVGIITNRDMRFI--------------------QDYSIKISDVMTKEITAPVGTTLDEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVI...... 208
245  5.000e-19 26  Azoarcus sp. EbN1 gi|56478023||ref|YP_159612.1| conserved hypothetical transmembrane protein [Azoa protmod 245 ....RCGDIMSEDVVTVGTQASIGETWALLARHKIKAIPVVAGEQRLVGIVSLHDFFIRRDLVGTMFI------------------GELMSDVVTARPDQPILELAKLFSDDGLHHVPVVDEHRNVVGMLTQSDLVAALVRTR.. 367
246  5.000e-19 18  Silicibacter pomeroyi DSS-3 gi|56678422||gb|AAV95088.1| nucleotidyltransferase/CBS/cyclic nucleotide-binding protmod 143 ....RVETLMARDPATCAPDTTVQAAAQEMRARSISSLCVC-EDGALVGILTQRDLSGKVVAE---------------ARSPDTPVDQVMTPPLTLAPSAIGSDVLHAMMERHIGHIPIV-EAGRLVGMVTQTDLTR........ 259
247  5.000e-19 20  Geobacter sulfurreducens PCA gi|39997293||ref|NP_953244.1| inosine-5`-monophosphate dehydrogenase [Geobacter protmod 86 .KVKKSESGMIVDPITMRPNQKIHEALAIMEKYRISGVPVTNSKGKLVGILTNRDLRFETNLDLPISARMTK------------------RRLVTVAVGTTLEEAKEHLKHTRVEKLLVVDEEKNLKGLITIKDIEK........ 203
248  5.000e-19 23  Moorella thermoacetica ATCC 39073 gi|49235276||ref|ZP_00329347.1| COG0517: FOG: CBS domain [Moorella thermoacetica protmod 3 .....VRDHMTPDPITVTKETSVLDALELMKKNKIRRLPVI-QDGRLIGLVTERDILRVSPSPASTLSVFEVNYL-----VAKMTVKDAMIKPVTVPPDMTIEEAALLMREHKIDNLLVM-EKERLVGIITQTDLFEALIK.... 132
249  5.000e-19 23  Haloarcula marismortui ATCC 43049 gi|55377595||ref|YP_135445.1| inosine-5`-monophosphate dehydrogenase [Haloarcula protmod 94 .RVKRADELIIRDVVTASPNQTVREVDEMMEHEGVSGAPVVDDDGEVLGIISGTDIRPYLEVG------------------EDDAVTDAMTDVVTAPEDVTPREALELMYDHKIERVPIVDGENRLVGLVTMQGILQ........ 213
250  5.000e-19 19  Moorella thermoacetica ATCC 39073 gi|49235274||ref|ZP_00329345.1| COG0517: FOG: CBS domain [Moorella thermoacetica protmod 4 .....ARDIMTTDVVVVHPEDPVGDVVKLFLEKGITCAVVVDQKGKLQGIVTDGDIMAAIRQRRPVYVEDTSDLNAKIKTLTSRPVKEIMTKVITANEEATIAEVAGLMTDHRIKQVPITSQD-RLVGLVRRHDIVQAVARN... 149
251  6.000e-19 20  Thermus thermophilus HB27 gi|46198773||ref|YP_004440.1| cyclic nucleotide binding protein/2 cbs domains [T protmod 138 ...RPVGELVQRPPVFVDPTASVEEAARRMREEGISSLLV---RGEPLGILTDRDLRNRVLAEGLP---------------PSTPVGQVATRPFTLPADTPLLEAVAAMLERRIHHLPLTRGE-EVVGVVTHTDLLAHQAQ.... 257
252  6.000e-19 17  Homo sapiens gi|46249821||gb|AAH68598.1| PRKAG2 protein [Homo sapiens] protmod 390 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 521
253  6.000e-19 23  Thermotoga maritima MSB8 gi|15643478||ref|NP_228524.1| tRNA nucleotidyl transferase-related protein [Ther protmod 303 ....RARDIMSSPVKVVLSNMTIKEVDRLMKQTGHSGFPVV-EGNRLVGIVTKKAVEKAMN-----------------HGLGDRPVKSIMTNLVVASPDTPVTRLRELMVEHAIGRIPIL-ENGILVGIVTRSDVLRAI...... 419
254  6.000e-19 22  Bacillus licheniformis ATCC 14580 gi|52078500||ref|YP_077291.1| inosine-monophosphate dehydrogenase [Bacillus lich protmod 87 .KVKRSERGVITNPFFLTPEHQVFDAEHLMGKYRISGVPIVDEDQKLVGIITNRDLRFISDYSM--------------------KISDVMTKEVTAPVGTTLDEAEKILQKYKIEKLPLLDDQGVLKGLITIKDIEKVI...... 208
255  6.000e-19 17  Methanosarcina barkeri str. fusaro gi|48839138||ref|ZP_00296072.1| COG1900: Uncharacterized conserved protein [Meth protmod 380 .....VKDVMSSFVVTIKRDQTVQDAAKKIWANSFNHLTVISDSGELVGILTAWDISKAVAENCF------------------DSVESVMTKKVTCAPNEPVDLAARRLDRYGVSAMPVIDAQRQVLGIITSDNISKLLAR.... 498
256  6.000e-19 25  Methanocaldococcus jannaschii DSM 2661 gi|15669617||ref|NP_248430.1| inosine-5`-monophosphate dehydrogenase, (guaB) [Me protmod 17 .....IKDIM-KKPIVVYEDNDLIDVIRLFRKNKISGAPVLNKDGKLVGIISESDIVKTIVTHPLKTALKIEEFMEDLKNALKTKVRDVMTKVIVAKPDMTINDAAKLMVKNNIKRLPVVDDEGNLIGIVTRGDLIEAL...... 167
257  6.000e-19 22  Bacillus subtilis subsp. subtilis str. 168 gi|16077988||ref|NP_388804.1| hypothetical protein BSU09230 [Bacillus subtilis s protmod 4 .....VKDTMTTQVATVSPNQTIQEAASLMKQHNVGAIPVV-EQGVLKGMLTDRDI---------------ALRTTAQGRDGQTPVSEVMTELVSGNPNMSLEDASQLMAQHQIRRLPIVDQNN-LVGIVALGDL.......... 117
258  6.000e-19 20  Staphylococcus aureus subsp. aureus MW2 gi|38604919||sp|Q8NY70|IMDH_STAAW Inosine-5`-monophosphate dehydrogenase (IMP de protmod 87 .KVKRSENGVISNPFFLTPEESVYEAEALMGKYRISGVPIVDEDRNLVGILTNRDLRFIEDFSI--------------------KIVDVMTNLITAPVNTTLEEAEKILQKHKIEKLPLV-KDGRLEGLITIKDIEKVI...... 207
259  7.000e-19 18  Dictyostelium discoideum gi|42733880||gb|AAS38797.1| similar to putative protein; protein id: At5g10860.1 protmod 110 .....VGDIIKKQIIYVKSNNTIYDAIKLMNNHGIGCLLVVSEDGSLVGIFTERD--------------YLGKVALMGKSSKETLVQDAMTKVVTINSKVGVVEAMKLMTEKRFRHIPVVDEDCNVIGLVSITDLIKTLRTNQKE 242
260  7.000e-19 22  Streptococcus pyogenes SSI-1 gi|28896765||ref|NP_803115.1| putative inosine monophosphate dehydrogenase [Stre protmod 89 .KVKRSENGVIIDPFFLTPEHKVSEAEELMQRYRISGVPIVEANRKLVGIITNRDMRFISN--------------------YNAPISEHMTSEVTAAVGTDLETAERILHEHRIEKLPLVDNSGRLSGLITIKDIEKVI...... 210
261  7.000e-19 22  Streptococcus pyogenes MGAS8232 gi|19747038||ref|NP_608174.1| inosine monophosphate dehydrogenase [Streptococcus protmod 89 .KVKRSENGVIIDPFFLTPEHKVSEAEELMQRYRISGVPIVEANRKLVGIITNRDMRFISD--------------------YNAPISEHMTSEVTAAVGTDLETAERILHEHRIEKLPLVDNSGRLSGLITIKDIEKVI...... 210
262  7.000e-19 21  Rubrobacter xylanophilus DSM 9941 gi|46106496||ref|ZP_00187354.2| COG0517: FOG: CBS domain [Rubrobacter xylanophil protmod 10 ....TVGDVMHADWPTLGPEDTVERAIRLFAESHISGAPVL-EDGRLVGIVTEGDLIFRDAEGGIIPLGSWEEYREETLKSAGVTVGEVMTDVVTVSPQTPLPEAATAMARRRIKLLPVVEGERLLRGVISRMDIL......... 151
263  7.000e-19 20  Staphylococcus aureus subsp. aureus MRSA252 gi|49482641||ref|YP_039865.1| putative inosine-5`-monophosphate dehydrogenase [S protmod 87 .KVKRSENGVISNPFFLTPEESVYEAEALMGKYRISGVPIVDEDRNLVGILTNRDLRFIEDFSI--------------------KIVDVMTNLITAPVNTTLEEAEKILQKHKIEKLPLV-KDGRLEGLITIKDIEKVI...... 207
264  7.000e-19 17  Homo sapiens gi|51105932||gb|EAL24516.1| protein kinase, AMP-activated, gamma 2 non-catalytic protmod 434 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 565
265  7.000e-19 19  Geobacter metallireducens GS-15 gi|48844127||ref|ZP_00298460.1| COG0517: FOG: CBS domain [Geobacter metallireduc protmod 1 .........MTTDVVSVKRETTIRELAEIFTKHRVGSVPVVDESGNLIGIVTESDLIEISLFDWVIYLESEKKFEKELQKMTGQTVGDLYTDTAMVTPDTPVSEVADIMSSKKLHALPVV-EGKRLVGMVSRIDLIRTMVK.... 142
266  8.000e-19 19  Bacillus clausii KSM-K16 gi|56964526||ref|YP_176257.1| acetoin utilization protein AcuB [Bacillus clausii protmod 1 MKIKT---IMRTNVPTLTNTDTIEDAIALMESASIRHIPITNGHTAVVGIVSDRDIRDIRPSTLSVTKEATDFL---------QPVTKIMSTPVTAHPDDDVQEVARLFFQNRVGCLPVVD-NDRLVGLITESDMLYSLTK.... 129
267  9.000e-19 26  Methanopyrus kandleri AV19 gi|20093963||ref|NP_613810.1| CBS-domain-containing protein [Methanopyrus kandle protmod 1 MRSVSVGEVARRDVITGSPTETAVEIAYKMREHGIGSVVIVNEKDEPIGIITERDLV--------------IKVVSQGKNPDEVIARDIMSQPVTVEEDMEVNEAVKLMVDKGIRRLPIVDDNGKLIGIVTMQDILQ........ 124
268  9.000e-19 25  Methanosarcina acetivorans C2A gi|20088906||ref|NP_614981.1| hypothetical protein MA0007 [Methanosarcina acetiv protmod 244 .....VKDIMTKNVVTVPSSMNIDELVQFMFEKKHMGYPVVDG-GSLKGIVTFTDIQRVSTLDR-----------------PVTRVSDIMTDIISVTSGAQASDALKLVTARNIGRVLVID-NGELVGVLSRTDLVRTL...... 359
269  9.000e-19 20  Magnetococcus sp. MC-1 gi|48832897||ref|ZP_00289923.1| COG2905: Predicted signal-transduction protein c protmod 157 .....IEDVMARSPITGTAHMSIREAAAKMTEIQVSSLLIVDEQEQLIGIITDRDLRKRVIVAGLD---------------TARPVADIMTNPSTIESAASVSEAQLMMMRTHIHHIPV-TKAGKLVGMITNTDLVR........ 273
270  9.000e-19 24  Methanocaldococcus jannaschii DSM 2661 gi|15669417||ref|NP_248227.1| hypothetical protein MJ1232 [Methanocaldococcus ja protmod 171 ....KVGDVGIKEVWTINPNCTLRETAKLFAEKYISGAPVVD-NDKLVGVISLHDI-------------------AENIDNIDKKVKEVMRDVITIHKDEKIYDALKIMNKNNVGRLVIVDDNNKIVGIITRTDILKIIS..... 287
271  9.000e-19 21  Streptomyces coelicolor A3(2) gi|5777683||emb|CAB53434.1| hypothetical protein [Streptomyces coelicolor A3(2)] protmod 1 .........MSRNVVRAGRTTPFKEVVRLLDRHRISGVPVLDDDDKVLGVVSGTDLVRAQA------------HRAGRRPARAVTAADVMSSPITVHPEQTVPDAARLMERRGVERLPVVDEEDRLIGIATRRDLLRVFLR.... 121
272  9.000e-19 23  Caulobacter crescentus CB15 gi|16125864||ref|NP_420428.1| inosine-5`-monophosphate dehydrogenase [Caulobacte protmod 84 ..VKRYESGMVINPLTIHPDTTLAEIREIKARRKISGFPVVERSGKLVGILTNRDMRFEGDDKV--------------------PASQLMTNLITVSEGVDHREARELLRRHKIERLIVVDEAYRAVGLITVKDIEKAQA..... 204
273  9.000e-19 24  Neisseria meningitidis Z2491 gi|7380040||emb|CAB84618.1| putative inosine-5`-monophosphate dehydrogenase [Nei protmod 84 .KVKRHESGVVKDPVTVAPTTLIREVLEMQRKRKMSGLPVV-ENGKVVGIVTNRDLRF--------------------ENRVDLPVSAIMTPLVTVPEGTSIDEARELMHTHKVERVLVLNEKDELKGLITVKDILKT....... 204
274  9.000e-19 18  Canis familiaris gi|57097445||ref|XP_532769.1| PREDICTED: similar to 5-AMP-activated protein kina protmod 382 ...........HNIAFIHPDTPIIKALNVFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 513
275  1.000e-18 22  Xanthomonas campestris pv. campestris str. ATCC 33913 gi|21231623||ref|NP_637540.1| inosine-5`-monophosphate dehydrogenase [Xanthomona protmod 85 .KVKKFESGVITEPFTVSPDTTIGEVIALTRARNISGVPVVDGS-ELVGIVTSRDMRF--------------------EKKLDDPVRHIMTKKITVREGASDEEVLELLHRNRIEKILVVNDSFELRGLITVKDIQK........ 202
276  1.000e-18 22  Thermobifida fusca gi|48836308||ref|ZP_00293305.1| COG0517: FOG: CBS domain [Thermobifida fusca] protmod 1 MDSTVVRDVMTAEPPSVVASTSFKTIVRTLINHRVSALPVVDEAGRVVGVVSEGDLLHKEEFIGGDDYSPPLRARNSAEKAAANRADQLMSHPVTVSPGTSAARAARVMERHGVKQLPVVTEGDYLVGMVTRRDLLMVFLRSDE. 159
277  1.000e-18 23  Nostoc sp. gi|25531016||pir||AC2417 hypothetical protein alr4891 [imported] - Nostoc sp. (s protmod 438 ....TAKDVMQQRVETLDAEITLEEAKQAFASSHHRGFPVV-EDNKLVGIITQSDLTKSLSRSLENNPH----------------LREIMTNPMTVTPIHTLSNVLYLLDRYQISRLPVV-EGQKLIGIITRADIIR........ 553
278  1.000e-18 22  Burkholderia pseudomallei K96243 gi|53719740||ref|YP_108726.1| inosine-5`-monophosphate dehydrogenase [Burkholder protmod 84 .KVKRFESGVVRDPITVPPSMKVRDVIALSRQHGISGFPVV-EGPKLVGIVTNRDLRFETR--------------------LDEPVKSIMTPLVTVAEGTPLAEAKALMHSHRLERVLVVNDAFELRGLMTVKDITK........ 201
279  1.000e-18 22  Streptococcus agalactiae NEM316 gi|25011667||ref|NP_736062.1| hypothetical protein gbs1627 [Streptococcus agalac protmod 3 .....VKDFMTKKLVYVSPDTTVAEAADLLREHHLRRLPVV-ENDQLLGLVTEGTMAEAQPSKATSLSIYEMNYLLNKTKIRDIMIKDI----VTVSQYASLEDAIYLMMSRKIGVLPVVD-NGQLYGIITDRDVFKAFLE.... 132
280  1.000e-18 22  Xanthomonas axonopodis pv. citri str. 306 gi|21108532||gb|AAM37141.1| inosine-5`-monophosphate dehydrogenase [Xanthomonas protmod 85 .RVKKFESGVITEPFTVSPDTTIGEVLALTRARNISGVPVVDGS-ELVGIVTSRDMRF--------------------EKKLDDPVRHIMTKKITVREGASDEEVLELLHRNRIEKVLVVNDSFELRGLITVKDIQK........ 202
281  1.000e-18 26  Methanococcus maripaludis S2 gi|45357696||ref|NP_987253.1| IMP dehydrogenase [Methanococcus maripaludis S2] g protmod 93 ..VKMAENLVIRDVVTVEPSSSVLDAERIMYEYNVSGLPVVSENKTLVGILTTRDLKFVPDKNVA--------------------VETVMTKEVLVHEDTPYEEILNRLYENKIERLPILDKNKELLGMVTLRDILK........ 209
282  1.000e-18 17  Methanosarcina acetivorans C2A gi|20090672||ref|NP_616747.1| hypothetical protein MA1821 [Methanosarcina acetiv protmod 380 .....VKDVMADFIVTIKKNQTVQDAAKKIWENSFNHLAVVSDTGELVGILTAWDISKAVAENIF------------------DSVESVMTKKVTCAPNEPVDLAARRLDRYGVSAMPVIDTQRKVLGIITSDNISKLLAR.... 498
283  1.000e-18 24  Neisseria meningitidis MC58 gi|7226438||gb|AAF41583.1| IMP dehydrogenase [Neisseria meningitidis MC58] gi|11 protmod 84 .KVKRHESGVVKDPVTVAPTTLIREVLEMQRKRKMSGLPVV-ENGKVVGIVTNRDLRF--------------------ENRVDLPVSAIMTPLVTVPEGTSIDEARELMHTHKVERVLVLNEKDELKGLITVKDILKT....... 204
284  1.000e-18 18  Magnetospirillum magnetotacticum MS-1 gi|46203008||ref|ZP_00052236.2| COG0516: IMP dehydrogenase/GMP reductase [Magnet protmod 63 ..VKKYESGMVLNPITIHPDETLADAFEVMKSNRISGIPVVERGGKLVGILTNRDVRFATN--------------------TGQPVAELMTRLITVREGVTQDEAKRLLHQFRIEKLLVVDDHYRCIGLITVKDIEKQVA..... 187
285  1.000e-18 17  Mus musculus gi|26328069||dbj|BAC27775.1| unnamed protein product [Mus musculus] protmod 308 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 439
286  1.000e-18 21  Rubrivivax gelatinosus PM1 gi|47571783||ref|ZP_00241832.1| COG0516: IMP dehydrogenase/GMP reductase [Rubriv protmod 84 .RVKRYESGLLRDPITISSGVRVQDVINLSRQHGISGFPVVD-DGKVVGIVTGRDLRFETR--------------------LDAPVREIMTPLVSVNEGATLEEAKSLMHRHKLERVVVVNAANELRGLFTVKDITK........ 201
287  1.000e-18 15  Rhodopirellula baltica SH 1 gi|32473238||ref|NP_866232.1| conserved hypothetical protein-putative inosine mo protmod 38 MPHVTAREMMVRNLITLSPTMDALEALDVLLRQRISGAPVVDGDGHFVGVFSEKSCMKFVVG-------------MAYENLPSIPVGDLTKNPPTISEETDLLTIAQTFLDAACRRLPVLDSEGRLRGQISRRDVMRAVRSHME. 169
288  1.000e-18 31  Methanocaldococcus jannaschii DSM 2661 gi|15668568||ref|NP_247366.1| hypothetical protein MJ0392 [Methanocaldococcus ja protmod 218 .KNIKAKDIMTPNPVYVTPDMSIEEFLDFMLKHKYFGYPVV-ENGKLVGCIGIGNIHKKEG-----------------------TVRDYMEKPVVVSEDTDIKEILRKMA--NTDRVFVV-EGGKLKGIISKTDILRAMS..... 329
289  1.000e-18 20  Haloarcula marismortui ATCC 43049 gi|55378301||ref|YP_136151.1| hypothetical protein rrnAC1525 [Haloarcula marismo protmod 124 .....VEDIYTRDVITVSEDTNVGQVVNLLRKHGISRLPVLGDDDGLTGMVTRHDIVDVVV--RDMNKTTRGDRSGEIERVLDMPVYDVMSSPVTAKLGDSVEDAVARMLENDFAGLVVTDDDTHVAGILTKTDVLRALTYTEEE 264
290  2.000e-18 21  Oceanobacillus iheyensis HTE831 gi|23097465||ref|NP_690931.1| inosine-5`-monophosphate dehydrogenase [Oceanobaci protmod 87 .KVKRSESGVITNPFFLTPEHQVYDAEHLMGKFRISGVPIVNEEQKLVGILTNRDLRFI--------------------QDYSISISEVMTNLVTAPVGTTLQEAEKLLQQYKIEKLPLVDDRNILKGLITIKDIEKVI...... 208
291  2.000e-18 23  Aeropyrum pernix K1 gi|14600580||ref|NP_147097.1| hypothetical protein APE0267 [Aeropyrum pernix K1] protmod 14 ....KAKHVMSTPPVTIEVGRSIAEAARLMAERGVGSLIVVDKQGLVKGILTERDIINSLA---------------SGKACAEGKVEDIMSNPIVASPDDDLEIIIEKMRDMNIRHIPVIDEDGRPLGMISVRDII......... 131
292  2.000e-18 19  Pasteurella multocida subsp. multocida str. Pm70 gi|15602160||ref|NP_245232.1| GuaB [Pasteurella multocida subsp. multocida str. protmod 85 .KVKKFESGIVSDPVTVSPTLSLAELSELVKKNGFASFPVVDDEKNLVGIITGRDTRFVTD--------------------LNKTVADFMTPKVTVKRNASRDEIFGLMHTHRVEKVLVVSDDFKLKGMITLKD........... 200
293  2.000e-18 21  Sulfolobus solfataricus P2 gi|15899455||ref|NP_344060.1| hypothetical protein SSO2740 [Sulfolobus solfatari protmod 67 ....KVKDIMSKDLVIVSPNDDVNHVVRIMLMNNIGGIPVVD-NNVIVGIFTEREILKLIASSMFSGL-----------------VDSVMSNIISIGEENTIMDAAKLMVMNNVRRLPVFSKDNRLVGIITAADIVKYLAKNK.. 188
294  2.000e-18 17  uncultured archaeon GZfos26B2 gi|52549159||gb|AAU83008.1| chloride channel [uncultured archaeon GZfos26B2] protmod 479 LENASVRDAMSVDVMPVNPTNNVQTVLNLITKYGHIGYPVLDDN-RLVGVVTFKDAERVQAGDR--------------EEVLVDQVMTPATSLIVTYPDESLEDALRKLVLNDIGRLPVVDRDDKILGIVTKSDIIRLHAQ.... 606
295  2.000e-18 18  Thermoplasma acidophilum DSM 1728 gi|16081428||ref|NP_393769.1| hypothetical protein Ta0289 [Thermoplasma acidophi protmod 4 ....RVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDVGLLSERSIIKRFIPRN--------------KKPDEVPIRLVMRKPIKVKSDYDVKDVAAYLSENGLERCAVVDDSGRVVGIVTLTDLSRYLSR.... 127
296  2.000e-18 18  Methanothermobacter thermautotrophicus str. Delta H gi|15678838||ref|NP_275955.1| sporulation protein IVFB related protein [Methanot protmod 221 ....RVADVMTENPVTLHPHMTVKEALDVMFREKHMGYPVT-EAGELRGIVTFHDISDAS---------------------RDLRVEDVMTDVVTVRDDEEVTGALEKMNRLQLGRLPVM-RDGKLTGIISRTDIVRTL...... 333
297  2.000e-18 22  Thermoplasma volcanium GSS1 gi|13542206||ref|NP_111894.1| Inosine-5`-monophosphate dehydrogenase [Thermoplas protmod 89 .RVKREETIIIRDVYTVSPETPIEVARTIMKTKNIAGLPVLKEE-KLVGILTKRDLEFA---------------------KQGSTVSDVMKNVITAPENVDLEDAINILHKNRIEKLPLVDKDNHLVGLITAKDII......... 202
298  2.000e-18 25  Thermoplasma acidophilum DSM 1728 gi|16081368||ref|NP_393697.1| probable inosine-5`-monophosphate dehydrogenase [T protmod 89 .RVKREETIIIRDVYTISPETPIEVARTLMATRNIAGLPVV-KDDKLVGIVTKRDLEFVKKGS---------------------SVSDVMRDVITAPENVDIDEAIEILHKNRIEKLPLVDSSGHLVGLITAKDII......... 202
299  2.000e-18 20  Methanothermobacter thermautotrophicus str. Delta H gi|15678154||ref|NP_275269.1| inosine-5`-monophosphate dehydrogenase related pro protmod 180 ...KTVAEVATRDLVTLAPDITVKEAAARLSSLGIEGAPIV-EDDEVKGIVTLSDI-----------------TASIAAGTEFMQVSDIMSNIITVKQDTMIADAIEVMNKHNIGRLIVTDSEGRPTGIITRTDILDSIA..... 299
300  2.000e-18 20  Synechococcus elongatus PCC 7942 gi|46129981||ref|ZP_00164643.2| COG0038: Chloride channel protein EriC [Synechoc protmod 437 ....TAAQVMASPVETLEASLPLTEVIQQFNRTHHRGFPVT-QKGALVGIVTSSDLDEQTLK----------------GKGESVRLSEIMTPPLTVAPQDTLAHVLYVLNRFQISRLPVVDG-RKLVGIITRADIIRA....... 553
301  2.000e-18 20  Synechococcus elongatus PCC 6301 gi|56750054||ref|YP_170755.1| probable chloride channel protein [Synechococcus e protmod 437 ....TAAQVMASPVETLEASLPLTEVIQQFNRTHHRGFPVT-QKGALVGIVTSSDLDEQTLK----------------GKGESVRLSEIMTPPLTVAPQDTLAHVLYVLNRFQISRLPVVDG-RKLVGIITRADIIRA....... 553
302  2.000e-18 16  Mus musculus gi|24371223||ref|NP_714966.1| protein kinase, AMP-activated, gamma 3 non-catatly protmod 357 ...........RDLAVVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 477
303  2.000e-18 19  Azotobacter vinelandii gi|23104719||ref|ZP_00091181.1| COG3448: CBS-domain-containing membrane protein protmod 238 .....AADIMSRDLRWATPETSFEDAWKLLRDHRLQQLPVIDGSRRLLGIVERGDL---LERSRPGFAWP------AFGRPARSGIGSAMGAPVVAHRDTHLAELVLPLSEQGLHCLPVVDDDARLVGLVTQTDLIAALYR.... 366
304  2.000e-18 18  Xenopus laevis gi|38051932||gb|AAH60444.1| MGC68503 protein [Xenopus laevis] protmod 423 ...........HNIAFIQPHTPIIKALNIFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALEHRSQYFEGV-------VKCSKPETLETIVDRIVKAEVHRLVVVDEADSIVGIISLSDILQAL...... 543
305  2.000e-18 23  Streptococcus agalactiae 2603V/R gi|22537717||ref|NP_688568.1| AcuB family protein [Streptococcus agalactiae 2603 protmod 3 .....VKDFMTKKLVYVSPDTTVAEAADLLREHHLRRLPVV-ENDQLVGLVTEGTMAEAQPSKATSLSIYEMNYLLNKTKIRDIMIKDI----VTVSQYASLEDAIYLMMSRKIGVLPVVD-NGQLYGIVTDRDVFKAFLE.... 132
306  2.000e-18 22  Methanosarcina mazei Go1 gi|21227420||ref|NP_633342.1| hypothetical protein MM1318 [Methanosarcina mazei protmod 244 .....VKDIMTKEVVSVPPSMNVEDLIQFMFEKKHMGYPVV-ESGNLKGIVTFTDIQRVPTIDRPVM-----------------RVSDIMTDIISVPSDAQASDVLKLVTSKNIGRVLVID-NGSLVGVLSRTDLVRIL...... 359
307  2.000e-18 21  Vibrio parahaemolyticus RIMD 2210633 gi|28897390||ref|NP_796995.1| inosine-5`-monophosphate dehydrogenase [Vibrio par protmod 87 .KVKKFEAGVVTDPVTVNPDATIADVVALTEKHGFAGFPVVTEHNELVGIITGRDVRFVTD--------------------LSKKVSAVMTPKASVKEGATREEVQEKMHEARVEKVLVVNDEFKLTGMITAKDFHKA....... 206
308  2.000e-18 20  Deinococcus radiodurans R1 gi|6459660||gb|AAF11432.1| inosine-5`-monophosphate dehydrogenase [Deinococcus r protmod 103 .KVKRSESGMIVDPITLPPSATVRDADRLMGEYRISGVPVTAPDGKLLGIITNRDMRFI--------------------DDLDVPLGDVMTREVTVPVGTDLEQARELFKLNRIEKLLVTEGEY-LRGLITIKDIEKSV...... 221
309  2.000e-18 20  Sulfolobus tokodaii str. 7 gi|15922445||ref|NP_378114.1| hypothetical protein ST2119 [Sulfolobus tokodaii s protmod 13 .............VHVIKENDSVKTAAEEMKKHNLGALVVIDDNDKIVGIITERDIVKVVAEGK-----------------LDAKVKDYMTNVIGVTEDTPITDALEIMLDHGFRHLPIIGKDGKVIGIVSIRDLSKAI...... 122
310  2.000e-18 17  Rattus norvegicus gi|34877142||ref|XP_237293.2| similar to AMP-activated protein kinase gamma 3 su protmod 456 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 576
311  3.000e-18 20  Dechloromonas aromatica RCB gi|53729683||ref|ZP_00348512.1| COG2905: Predicted signal-transduction protein c protmod 184 ..........SRSPVTVSPDTPLRAALETMSQAGVGSLVIAGEDRKAVGVFTRTDLLDRVVLADLP---------------LTTPIAQAMSNPFMIEEHATAYDAMFAMATHGIRHVLVTDAEGKLTGVVSERDL.......... 294
312  3.000e-18 19  Azotobacter vinelandii gi|23105162||ref|ZP_00091620.1| COG0516: IMP dehydrogenase/GMP reductase [Azotob protmod 85 .KVKRFEAGVLRDPITIDADATVRDLFELTRQHDISGVPVLSR-GDLVGIVTSRDVRFETR--------------------LDARVREVMTPKVTVREGADKEEARQLLHKHRIERVLIVDDAFRLKGMMTVTDIEKA....... 203
313  3.000e-18 22  Burkholderia cepacia R1808 gi|46318950||ref|ZP_00219375.1| COG0516: IMP dehydrogenase/GMP reductase [Burkho protmod 84 .KVKRFESGVVRDPITVPPQMKVRDVIALSRQHGISGFPVV-EGPQLVGIVTNRDLRFESR--------------------LDEPVKSIMTPLVTVKEGTPLAEAKALMHSHRLERVLVVNDAFELRGLMTVKDITK........ 201
314  3.000e-18 20  Exiguobacterium sp. 255-15 gi|46112920||ref|ZP_00182027.2| COG0516: IMP dehydrogenase/GMP reductase [Exiguo protmod 87 .RVKRSENGVITNPFYLTPERQVYDAEYLMSKYRISGVPIVNNERKLVGILTNRDLRFV--------------------KDYSTVIETVMTTEVTAKVGTSLEEAEQILHKHRIEKLPLVDENGVLKGLITTKDIEK........ 206
315  3.000e-18 22  Burkholderia cepacia R18194 gi|46311911||ref|ZP_00212512.1| COG0516: IMP dehydrogenase/GMP reductase [Burkho protmod 84 .KVKRFESGVVRDPITVPPQMKVRDVIALSRQHGISGFPVV-EGPQLVGIVTNRDLRFETR--------------------LDEPVKSIMTPLVTVKEGTPLAEAKALMHSHRLERVLVVNDAFELRGLMTVKDITK........ 201
316  3.000e-18 18  Bacillus licheniformis ATCC 14580 gi|52081470||ref|YP_080261.1| acetoin dehydrogenase [Bacillus licheniformis ATCC protmod 3 .....VEKIMKRDVVTLSRTDTIEEAIKRMRTFHIKHLPVINERGTVIGIVTDRDVKTASPSIFAQNRSNED---------LKKPVELIMSKEVTGHPLDFAEEISAVFFEHEIGCLPIV-KNGKLVGIVTKSDLLHTFVQ.... 129
317  3.000e-18 28  Pseudomonas aeruginosa PAO1 gi|9949941||gb|AAG07157.1| inosine-5`-monophosphate dehydrogenase [Pseudomonas a protmod 85 .KVKKHETAIVRDPVTVTPSTKIIELLQMAREYGFSGFPVV-EQGELVGIVTGRDLR--------------------VKPNAGDTVAAIMTPKVTAREGTPLEEMKAKLYENRIEKMLVVDENFYLRGLVTFRDIEKA....... 203
318  3.000e-18 13  Caenorhabditis elegans gi|31043924||emb|CAC35836.2| Hypothetical protein Y111B2A.8 [Caenorhabditis eleg protmod 384 ............DILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQ-------TCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNL...... 503
319  4.000e-18 20  Xylella fastidiosa Temecula1 gi|28199329||ref|NP_779643.1| inosine-5`-monophosphate dehydrogenase [Xylella fa protmod 85 .KVKKYESGVIRDPITVDPETSIRDVLALTRAKNISGVPVVDK-GQLIGLVTHRDMRF--------------------ERELDDPVRHIMTKKVTVKEGADSQEVLQLLHKHRIEKILVVNDAFELRGLITVKDIQK........ 202
320  4.000e-18 21  Aeropyrum pernix K1 gi|14601112||ref|NP_147639.1| hypothetical protein APE0974 [Aeropyrum pernix K1] protmod 208 ....KVNSLISRKLLTVRHDMTVREVAKFLYSHGIRGAPIVDDKNNIIGFITTTDISMLIARG--------EDLDATVDKYMRKTV-------FTINEDESIYEAMRYMDFNGVGRLVVIDYAGRPLGIITRTDILKALIAVK.. 331
321  4.000e-18 16  Xenopus laevis gi|27694601||gb|AAH43738.1| Prkag3-prov protein [Xenopus laevis] protmod 205 ...........RDIAVVQDTSSVYNALEIFVERRVSALPVVNESGQVVGLYSRFDVIHLAAQKIYNNLDISVLDALRLRSLCIEGV-------LMCYPHESLEVVIDRIVREQIHRLVLVDEERRPLGIVSLSDILQAL...... 325
322  4.000e-18 20  Vibrio vulnificus CMCP6 gi|27363887||ref|NP_759415.1| IMP dehydrogenase [Vibrio vulnificus CMCP6] gi|273 protmod 85 .KVKKFEAGVVTDPVTVSPDATIADVVALTDKHGFAGFPVVTESNELVGIITGRDVRFVTD--------------------LSKKVSSVMTNLAAVKEGATRAEVQEKMHEARVEKVLVVNDDFQLTGMITAKDFHKA....... 204
323  4.000e-18 19  Xylella fastidiosa 9a5c gi|15839021||ref|NP_299709.1| inosine-5`-monophosphate dehydrogenase [Xylella fa protmod 85 .KVKKYESGVIRDPITVDPETSIRDVLALTRAKNISGVPVVDK-GQLIGLVTHRDMRF--------------------ESELDDPVRHIMTKKVTVKEGADSQEVLQLLHKHRIEKILVVNDAFELRGLITVKDIQK........ 202
324  4.000e-18 20  Vibrio vulnificus YJ016 gi|37678959||ref|NP_933568.1| inosine-5`-monophosphate dehydrogenase [Vibrio vul protmod 87 .KVKKFEAGVVTDPVTVSPDATIADVVALTDKHGFAGFPVVTESNELVGIITGRDVRFVTD--------------------LSKKVSSVMTNLAAVKEGATRAEVQEKMHEARVEKVLVVNDDFQLTGMITAKDFHKA....... 206
325  4.000e-18 22  Vibrio vulnificus YJ016 gi|58426411||gb|AAW75448.1| inosine-5`-monophosphate dehydrogenase [Xanthomonas protmod 85 .RVKKFESGVITEPFTVRPDTTIGEVLALTRARNISGVPVVDGS-ELVGIVTSRDMRF--------------------EKKLDDPVRHIMTKKITVREGASDEEVLELLHRNRIEKVLVVNHSFELRGLITVKDIQK........ 202
326  4.000e-18 20  Xylella fastidiosa Ann-1 gi|22996697||ref|ZP_00040944.1| COG0516: IMP dehydrogenase/GMP reductase [Xylell protmod 85 .KVKKYESGVIRDPITVDPETSIRDVLALTRAKNISGVPVVDK-GQLIGLVTHRDMRF--------------------ERELDDPVRHIMTKKVTVKEGADSQEVLQLLHKHRIEKILVVNDAFELRGLITVKDIQK........ 202
327  4.000e-18 18  Pseudomonas putida KT2440 gi|26989073||ref|NP_744498.1| CBS domain protein [Pseudomonas putida KT2440] gi| protmod 240 ....TAASVMSRDVQFATPDTTLEQAWKMLASHHLKTLPVL-QHGKLVGIVSLSDLVGAMQRGRFSWRGLFGRQAVRMAQVMSRRV-------VSVSSQHPLERLLPLLCEQGLHCLPVLDGD-KLVGVITQTDLIAGLKRQ... 369
328  4.000e-18 21  Bacillus licheniformis ATCC 14580 gi|52079398||ref|YP_078189.1| ABC transporter [Bacillus licheniformis ATCC 14580 protmod 3 ....TISNAMSRQVATISSNQTVQEAAELMSRHNVGAIPVVD-QGVLKGMITDRDIT---------------LRTTAEGQDGQTPVSNVMTNVVSGNPNMSLEEASQLMAQSQIRRLPIV-ENNHLVGILALGDL.......... 117
329  4.000e-18 16  Mus musculus gi|24371227||ref|NP_714967.1| protein kinase, AMP-activated, gamma 3 non-catatly protmod 332 ...........RDLAVVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 452
330  4.000e-18 20  Ralstonia eutropha JMP134 gi|53761340||ref|ZP_00166814.2| COG0516: IMP dehydrogenase/GMP reductase [Ralsto protmod 84 .RVKRYESGVLRDPITISPDMKVREVIALSQQHGISGFPVL-EGKTVVGIITNRDLRF--------------------EEELDAPVRAKMTPLVTVAEGAPLEEAKRLMNRHRLERVLVVNAAFELRGLITVKDIQKAV...... 203
331  4.000e-18 18  Thermoplasma acidophilum gi|42543314||pdb|1PVM|B Chain B, Structural Genomics, A Conserved Hypothetical P protmod 10 ....RVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDVGLLSERSIIKRFIPRN--------------KKPDEVPIRLVMRKPIKVKSDYDVKDVAAYLSENGLERCAVVDDPGRVVGIVTLTDLSRYLSR.... 133
332  5.000e-18 26  Methanopyrus kandleri gi|1002715||gb|AAA92086.1| similar to the inosine monophosphate dehydrogenase fr protmod 1 MRTVSVGEVARRDVITGSPTETAVEIAYKMREHGIGSVVIVNEKDEPIGIITERDLV--------------IKVVSQGKNPDEVIARDIMSQPVTVEEDMEVNEAVKLMVDKGIRRLPIVDDNGKLIGIVTMQDILQ........ 124
333  5.000e-18 20  Listeria innocua Clip11262 gi|16801960||ref|NP_472228.1| guaB [Listeria innocua Clip11262] gi|16804795|ref| protmod 87 .KVKRSESGVIIDPFYLTPDHQVFAAEHLMGKYRISGVPIVNKERKLVGILTNRDLRFISD--------------------YSTVIKDVMTNLVTAPVGTTLKQAEQILQKHRIEKLPLVDEAGILKGLITIKDIEKVI...... 208
334  5.000e-18 21  Acinetobacter calcoaceticus gi|38720||emb|CAA47328.1| IMP dehydrogenase [Acinetobacter calcoaceticus] gi|400 protmod 85 .RVKKFEAGMVKDPITVSPETTVRELIAITSANNISGVPVV-KDSKVVGIVTGRD--------------------TRFETNLEQPVSNIMTRLVTVREGESKENIQALLQKHRIEKVLVVGESNELKGLITVTDFRKA....... 203
335  5.000e-18 19  Ralstonia metallidurans CH34 gi|48768215||ref|ZP_00272566.1| COG0516: IMP dehydrogenase/GMP reductase [Ralsto protmod 84 .RVKRYESGVLRDPITISPEMKVRDVIALSQQHGISGFPVL-EGKTVVGIITNRDLRF--------------------EEELDAPVRAKMTPLVTVAEGAPLEEAKRLMNRHRLERVLVVNGAFELRGLITVKDIQKAV...... 203
336  5.000e-18 24  Archaeoglobus fulgidus DSM 4304 gi|11498453||ref|NP_069681.1| inosine monophosphate dehydrogenase (guaB-1) [Arch protmod 7 .....VKEVMTTVVCTVKRTDSVHNLAKKLVEYGVGSAVVV-EDGRPVGIVTEKDLI--------------SKIVARNKVPSKVLVEEVMSQPVTIGPNTSLREAARIMMKRGIRRLPVVNNNQELIGIITDNDIL......... 123
337  5.000e-18 24  Vibrio parahaemolyticus gi|1794166||dbj|BAA11216.1| unnamed protein product [Vibrio parahaemolyticus] protmod 101 ...KRAKDLANHNVVVVHPNQSIQQVAQIMSKKGCTCALVTNDN-ALVGMVTETDMTSRVVAEAFN---------------IYRPVEDIMAHPQSVDQDEPVISALNLMMKHNIRNIPVLDKNKQVLGLISPQELVQ........ 219
338  5.000e-18 17  Nostoc punctiforme PCC 73102 gi|53687243||ref|ZP_00107499.2| COG0038: Chloride channel protein EriC [Nostoc p protmod 450 .....AADVMQRRVETLSSQMSIDEAVQAFSDSHHRNFPIL-EKGKVVGIVTQKDLVNLASQQLSG----------------NTTISQIMTPPVTASPTATLAYVLHILNRYHLSCLPV-TEGRKLVGIITRSDIIRVEAE.... 568
339  5.000e-18 19  Xylella fastidiosa Dixon gi|22994289||ref|ZP_00038799.1| COG0516: IMP dehydrogenase/GMP reductase [Xylell protmod 85 .KVKKYESGVIRDPITVDPETSIRDVLALTRAKNISGVPVVDK-GQLIGLVTHRDMRF--------------------ESELDDPVRHIMTKKVTVKEGADSQEVLQLLHKHRIEKILVVNDAFELRGLITVKDIQK........ 202
340  5.000e-18 22  Rhodobacter capsulatus gi|3128277||gb|AAC16129.1| hypothetical protein [Rhodobacter capsulatus] gi|7469 protmod 141 ...QKVADLIARKPLACAPDTPAIAAAQQMRAAHVSSLGVVAADGTLLGIVTQRDLSNKILAE---------------GQAPETPVAAVMTDPVSLPPTALGSDILHIMLERRIGHLPI-TEAGRFVGMITQTDLTR........ 259
341  6.000e-18 26  Archaeoglobus fulgidus DSM 4304 gi|11498454||ref|NP_069682.1| hypothetical protein AF0848 [Archaeoglobus fulgidu protmod 81 .....VETIMEREVVTVNESDSLEEAVETMFEKNVGGCPIVNKDDVVVGIITERDILKYLGANRSIDGV----------------ASDYMTSVITLRPKDSIERAMRTMIEKKLRRIPIID-DGILVGLITVREILR........ 196
342  6.000e-18 21  Escherichia coli gi|41627||emb|CAA26133.1| unnamed protein product [Escherichia coli] protmod 108 .RVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTD--------------------LNQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKAEAK.... 230
343  6.000e-18 20  Methanosarcina barkeri str. fusaro gi|48839762||ref|ZP_00296692.1| COG0517: FOG: CBS domain [Methanosarcina barkeri protmod 231 .TNRTVDEYMTENVKMVSTDTPIGQAAKVMVDNRLRRLPVV-KDGIFAGIITSSDIIHFLGNGEA----FSKLTTGNIHEALDQPVGSIVSDLIWTGPGTDLGKAMEIMLEKKIGSLPVLD-NGLLRGIITERDLLRSL...... 363
344  6.000e-18 17  Polaromonas sp. JS666 gi|54028601||ref|ZP_00360749.1| COG3448: CBS-domain-containing membrane protein protmod 248 ....RCADVMSRELVTVQFGTPLQEAWALLRSRRIKALPVVDRAFRIAGIITVADFMRAAELDVYEGFEDKVRTTRSVYASKPEVVGQIMTRNVRVAMQRRLLDLIPLFGSTGHHHIPILGEGERLVGMITQSDLVAALGR.... 389
345  6.000e-18 18  Rhodobacter sphaeroides 2.4.1 gi|46193059||ref|ZP_00005470.2| COG2905: Predicted signal-transduction protein c protmod 138 LTTQKVADLMARKPVTCGPAETIRAAAMKMRDAGVSSLGVV-EGSAFLGIVTTRDMTNKVVATGLD---------------PSTPVAEVMTDPIALAPEALGSDILHVMLERRIGHLPVV-EEGRLVGMITQTDLTR........ 258
346  6.000e-18 19  Plasmodium yoelii yoelii gi|23485248||gb|EAA20309.1| transmembrane protein, putative [Plasmodium yoelii y protmod 238 ........IMTPEPLTAEFGDDLESVWRRMQRHGIRALPVVDRGRHVIGIVTFKDFFRHAPADGFGSLKARLKALLRVTSTKPEVVGQIMTAPITARHDAPIVELARLLSEHGIHQVPIVDERRKLVGV................ 363
347  6.000e-18 21  Escherichia coli gi|146275||gb|AAB18618.1| IMP dehydrogenase [Escherichia coli] protmod 85 .RVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTD--------------------LNQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKAEAK.... 207
348  6.000e-18 19  Yersinia pseudotuberculosis IP 32953 gi|51597149||ref|YP_071340.1| inosine-5`-monophosphate dehydrogenase [Yersinia p protmod 113 .RVKKHESGVVTEPQTVTPTTTLRQVKELTARNGFAGYPVVTEDYELVGIITGRDVRFVTD--------------------LDQPVTAVMTPKVTVKEGETREVVLQKMHEKRVEKVLVVDDSFHLRGMITVKDFQKA....... 232
349  6.000e-18 23  Ferroplasma acidarmanus gi|48853001||ref|ZP_00307182.1| COG0516: IMP dehydrogenase/GMP reductase [Ferrop protmod 89 .KVKKEESIIIRDVFSIASDTPVNVARTLMKTKNIAGLPVVA-SGKLIGILTKRDLEFSESEG---------------------TVKDIMTDVITADENVSIEDAKFILYKNRVEKLPLVDSKGRLVGLITAKDI.......... 201
350  6.000e-18 17  Homo sapiens gi|47132577||ref|NP_059127.2| AMP-activated protein kinase, non-catalytic gamma- protmod 357 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 477
351  6.000e-18 21  Burkholderia fungorum LB400 gi|48787669||ref|ZP_00283648.1| COG0516: IMP dehydrogenase/GMP reductase [Burkho protmod 84 .KVKRFESGVVRDPITVPPQMKVRDVIALSRQHGISGFPVVEGA-QLVGIVTNRDLRF--------------------EERLDEPVRNIMTPLVTVKEGTPLAEAKALMHSHRLERVLVINDAFELRGLMTVKDITK........ 201
352  6.000e-18 19  Pyrobaculum aerophilum str. IM2 gi|18313985||ref|NP_560652.1| conserved protein with 2 CBS domains [Pyrobaculum protmod 162 .....IKNIMTPNPIVARTDDPLEAYIKYFVEKRFRGIPVIDDDKRPIGLLMASRVMDALANCN-----------------LKTKVSNLMRNPPVINEDEDIHEAIRLMVSSGIGRLLVVNSEDKLVGIITRTDILTRIA..... 280
353  6.000e-18 19  Halobacterium salinarum NRC-1 gi|15790611||ref|NP_280435.1| hypothetical protein VNG1663C [Halobacterium salin protmod 123 ....DVRDIYTEHVVTVDEDDSMGRVINLLREHGISRLPVVDDAGLLSGIVTRYDI--VDFVVRDTEKTTVGDRSGEIERLLDLPVSDEMTSPVTASFDDSVRDAVDDMLAHDYSGVIVTDDERAVGGILTKTDVLRALSYTEEE 264
354  6.000e-18 22  Neurospora crassa gi|32420219||ref|XP_330553.1| hypothetical protein [Neurospora crassa] gi|289267 protmod 118 .KVKRYENGFILDPVVITRDTTVGEAKALKEKWGFGGFPVTESGNKLVGIVTNRDIQFETD--------------------LDKPVSEVMTDLITATAGVNLLEANKILAESKKGKLPIIDKEGNLVSMISRSDLTKNL...... 239
355  7.000e-18 16  Pongo pygmaeus gi|55733124||emb|CAH93246.1| hypothetical protein [Pongo pygmaeus] protmod 389 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVANEADSIVGIISLSDILQALAKQKE. 520
356  7.000e-18 18  Ralstonia eutropha JMP134 gi|46131199||ref|ZP_00202516.1| COG0517: FOG: CBS domain [Ralstonia eutropha JMP protmod 28 ....RLRDVMTPNPQYITPDCTLQEAAKLMDDLNVGTLPVCV-DGQLRGMVTDRDI--------------TCRCIAVGKDPQTRIVDAMSERPLWCRDDDTIDDALAKMAERQIRRVPVIDKDDRLVGIVSLGDI.......... 143
357  7.000e-18 27  Thermus thermophilus HB8 gi|55981029||ref|YP_144326.1| Mg2+ transporter MgtE [Thermus thermophilus HB8] g protmod 137 ........LMTPEYVAVREGMTVEEVLRFLRRETIYYIYVVDEKGRLKGVLSLRDLIVADPR---------------------TRVAEIMPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLVGIVTVDDVLDVL...... 252
358  7.000e-18 17  Homo sapiens gi|6688201||emb|CAB65117.1| AMP-activated protein kinase gamma 3 subunit [Homo s protmod 357 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRKRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 477
359  8.000e-18 15  Rubrivivax gelatinosus PM1 gi|47574215||ref|ZP_00244251.1| COG2905: Predicted signal-transduction protein c protmod 193 ...RRLGELATPAPRTCRPDTPLALALQAMQQHRIGSMLVTDDLGAPAGILTRYDILDRITLPQLP---------------LSTPIAAVMTQPVHATVDHTAQDAALLMSRHGLRHVPI-TSSGRLVGVVSERDL.......... 309
360  8.000e-18 17  Nostoc punctiforme PCC 73102 gi|53687341||ref|ZP_00107695.2| COG0038: Chloride channel protein EriC [Nostoc p protmod 452 .......DVMQRRVETLSSQMSTDEAVQAFSHSHHRNFPVL-ENGKVVGIVTQKNLVNI----------------ASEQLGKDTTIGEIMTPPVTVTPTATLAHVLHILNRYHLSCLPV-TENRKLIGIITRSDIIRVEAE.... 568
361  9.000e-18 13  Caenorhabditis elegans gi|17556677||ref|NP_499637.1| CBS domain containing protein (3N628) [Caenorhabdi protmod 174 ............DILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQ-------TCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNL...... 293
362  9.000e-18 17  Homo sapiens gi|8215682||gb|AAF73987.1| AMP-activated protein kinase gamma subunit [Homo sapi protmod 332 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 452
363  9.000e-18 26  Sulfolobus tokodaii str. 7 gi|15922679||ref|NP_378348.1| hypothetical protein ST2348 [Sulfolobus tokodaii s protmod 1 MEEEIVKEYMKTQVISVTKDAKLNDIAKVMTEKNIGSVIVVDGN-KPVGIITERDIVKAIGK----------------GKSLETKAEEFMTSLITIREDSPITGALALMRQFNIRHLPVVDDKGNLKGIISIRDITRAI...... 123
364  9.000e-18 19  Yersinia pestis CO92 gi|16123063||ref|NP_406376.1| inosine-5`-monophosphate dehydrogenase [Yersinia p protmod 85 .RVKKHESGVVTEPQTVTPTTTLRQVKELTARNGFAGYPVVTEDYELVGIITGRDVRFVTD--------------------LDQPVTAVMTPKVTVKEGETREVVLQKMHEKRVEKVLVVDDSFHLRGMITVKDFQKA....... 204
365  9.000e-18 17  Sus scrofa gi|47522968||ref|NP_999242.1| AMP-activated protein kinase gamma subunit [Sus sc protmod 382 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNETGQVVGLYSRFDVIHLAAQQTYNHLDMNVGEALRQRTLCLEGV-------LSCQPHETLGEVIDRIVREQVHRLVLVDETQHLLGVVSLSDILQAL...... 502
366  1.000e-17 22  Bacillus cereus G9241 gi|47565083||ref|ZP_00236126.1| acetoin utilization protein AcuB, probable, puta protmod 3 .....VEEIMNQDVVTLHPNDTIETAIRTIRTKGIRHIPIVDQNNHVVGIISDRDVRDASPSILDEQVPLA---------MLKQPLDLIMKQPVTCHPLDFVEEIATLFFENKIGCLPV-TKAGKLVGIISESTVLHTLVK.... 129
367  1.000e-17 23  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50122131||ref|YP_051298.1| inosine-5`-monophosphate dehydrogenase [Erwinia ca protmod 85 .RVKKYESGVVVDPQTVAPETTLREMRELTERNGFAGYPVVAKDNELVGIITGRDVRFVTD--------------------LEKPVSAFMTPKVTVNEGEARDVVLQKMHEKRVEKALVVDDKFHLIGMITVKDFQKA....... 204
368  1.000e-17 19  Streptococcus pyogenes gi|7546367||pdb|1ZFJ|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh; Ec 1 protmod 88 .KVKRSENGVIIDPFFLTPEHKVSEAEELXQRYRISGVPIVEANRKLVGIITNRDXRFISDYNAPISEHXTSE------------------HLVTAAVGTDLETAERILHEHRIEKLPLVDNSGRLSGLITIKDIEKVI...... 209
369  1.000e-17 21  Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150 gi|56412607||ref|YP_149682.1| inosine-5`-monophosphate dehydrogenase [Salmonella protmod 85 .RVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTEDNELVGIITGRDVRFVTD--------------------LNQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLGMITVKDFQKA....... 204
370  1.000e-17 20  Escherichia coli gi|1805568||dbj|BAA16395.1| IMP dehydrogenase (EC 1.1.1.205) [Escherichia coli] protmod 108 .RVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTD--------------------LNQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKA....... 227
371  1.000e-17 22  Bacillus cereus ZK gi|52140839||ref|YP_085991.1| acetoin utilization protein [Bacillus cereus ZK] g protmod 3 .....VEEIMNQDVVTLHPNDTIETAIRTIRTKGIRHIPIVDQNNHVVGIISDRDVRDASPSILDEQVSL---------DMLKQPLELIMKHPVTCHPLDFVEEIATLFFENKIGCLPV-TKAGKLVGIISESTVLHTLVK.... 129
372  1.000e-17 22  Bacillus cereus ATCC 14579 gi|30022736||ref|NP_834367.1| Acetoin utilization acuB protein [Bacillus cereus protmod 3 .....VEEIMNQNVVTLHPNDTIETAIRTIRTKGIRHIPIVDQNNHVVGIISDRDVRDASPSILDEQVSL---------DMLQQPLELIMKHPVTCHPLDFVEEIATLFFENKIGCLPV-TKAGKLVGIISESTVLHTLVK.... 129
373  1.000e-17 20  Escherichia coli CFT073 gi|26248869||ref|NP_754909.1| Inosine-5`-monophosphate dehydrogenase [Escherichi protmod 108 .RVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTD--------------------LSQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKA....... 227
374  1.000e-17 21  Salmonella enterica subsp. enterica serovar Typhi Ty2 gi|29140875||ref|NP_804217.1| inosine-5`-monophosphate dehydrogenase [Salmonella protmod 87 .RVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTEDNELVGIITGRDVRFVTD--------------------LNQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLGMITVKDFQKA....... 206
375  1.000e-17 20  Bacillus halodurans C-125 gi|10175859||dbj|BAB06955.1| acetoin dehydrogenase [Bacillus halodurans C-125] g protmod 3 .....IEEIMKRNVVTIHEQTTIKEAYQTMILEKFRHLPVITKSKDVIGIVTDQDIRDASPSIFHQDEHQED---------LQKPVSSIMTDVITVHPLNSVAETARLLYENRISCLPV-TEGEQLVGIVTDTDVLHTLVE.... 129
376  1.000e-17 17  Desulfotalea psychrophila LSv54 gi|51246682||ref|YP_066566.1| related to acetoin utilization protein (AcuB) [Des protmod 3 .....ISEYMTPEPLTIYPHTLLPEARGILDAFKFRHLPVVDDGQRLLGIITDRDLRSAYPSSLESGEESSGKFLG----VEKTPVSEIMTNCATIHPQATLDDALFLFDREKVGGVPVVNDQDLVVGMFSIRDLIAA....... 132
377  1.000e-17 20  Shigella flexneri 2a str. 301 gi|56480121||ref|NP_708347.2| IMP dehydrogenase [Shigella flexneri 2a str. 301] protmod 85 .RVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTD--------------------LNQPVSVYMTPKVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKA....... 204
378  2.000e-17 20  Desulfovibrio desulfuricans G20 gi|53691479||ref|ZP_00346825.1| COG0038: Chloride channel protein EriC [Desulfov protmod 425 LRSLKVGEFMRADPPTIWEGTPLHDVILAFRQRDVSYLHVVDREGGLKGIISFRDLRAVLADEYPARLVIAGDIAT--------------TRLVTVTEGDSIQCALGRMSRSGIAQLPVVEDARRLKGILREKDVIHA....... 550
379  2.000e-17 19  Thermobifida fusca gi|48836601||ref|ZP_00293597.1| COG1253: Hemolysins and related proteins contain protmod 204 ....TVREVMIPRPVFLEGNVSIEEALEKALSSGYSRIPVIGESDDVIGIVYLKDLVARLYDAWRANGGAP---------APGRTIRDVMREPTYVPDSKPVDELLREMQQQRIHLAVVIDEYGGTAGIVTIEDIVEEI...... 332
380  2.000e-17 25  Aeropyrum pernix K1 gi|14600673||ref|NP_147193.1| hypothetical protein APE0383 [Aeropyrum pernix K1] protmod 2 ......RDIMSSPPITTLPMTSVKEAAKIMLENRVGSLIVVNERNTLLGILTKTDIIREVVAKGL--------------DPESVRVGDIMTNPYYVYTDDSVERAASLMGEHNIGHLPVLDETEKPVGIVTKTDIVK........ 120
381  2.000e-17 24  Rhodopseudomonas palustris CGA009 gi|39937301||ref|NP_949577.1| CBS domain [Rhodopseudomonas palustris CGA009] gi| protmod 1 .........MTRAVKSVSRELTMRELEDKFEHDDFNAYPVV-EDQRVIGMVTKYDFLSCFAFHPTQMLPHYDDL-------MNRSVGDIMSDFLYVHSDTKLTRVLQLMVEHQTRSIPVLDADRKLDGIISREDVIKALA..... 124
382  2.000e-17 17  Mus musculus gi|26330194||dbj|BAC28827.1| unnamed protein product [Mus musculus] protmod 132 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 263
383  2.000e-17 23  Methanosarcina barkeri str. fusaro gi|48838444||ref|ZP_00295387.1| COG0038: Chloride channel protein EriC [Methanos protmod 441 MTSIPVKAAMITSVQTVSEDKSVEILEALMKASRHIGFPVVDSKGKLSGIVTLSDLRNKVKPGEVG-----------------KKIGEIATREVVAYPDETLDTALKRLASKQIGRLPVVDREDKLLGIITRSDIVNA....... 564
384  2.000e-17 23  Arabidopsis thaliana gi|7270361||emb|CAB80129.1| putative protein [Arabidopsis thaliana] gi|2911050|e protmod 78 ....TVGDFMTPNLHVVKPSTSVDDALELLVEKKVTGLPVIDDNWTLVGVVSDYDLLALDSISVFSFGQTFNELQKLISKTYGKVVGDLMTPPLVVRDSTNLEDAARLLLETKFRRLPVVDADGKLVSI................ 241
385  2.000e-17 17  Sus scrofa gi|8215686||gb|AAF73989.1| AMPK gamma subunit [Sus scrofa] gi|37956600|gb|AAP125 protmod 332 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNETGQVVGLYSRFDVIHLAAQQTYNHLDMNVGEALRQRTLCLEGV-------LSCQPHETLGEVIDRIVREQVHRLVLVDETQHLLGVVSLSDILQAL...... 452
386  2.000e-17 18  Azoarcus sp. EbN1 gi|56478249||ref|YP_159838.1| putative nucleotidyltransferase [Azoarcus sp. EbN1 protmod 171 ......GELVKKEAIFVTPGTSIRAALEKMSEMRLGCMVIVDAEQRPVGILTQSDLLSRIVLPAID---------------LQRPVSEVMTDPHRMPASASAYDAALEMATHGVRHLLVTDSDDRLKGVVSERDL.......... 285
387  2.000e-17 15  Methanococcoides burtonii DSM 6242 gi|41718623||ref|ZP_00147602.1| COG0038: Chloride channel protein EriC [Methanoc protmod 428 MEAMFVRDNMRTNVHTISDDDTAKDLLDLMQSSRHAGFPVLDGNKKLCGIVTLEDMREKVNYGE-----------------LDIRISQIATNVISAYPDETLDVVLKRFAMRDVGRLPVVDDDKSLLGIITRSDIVK........ 550
388  2.000e-17 17  Methanopyrus kandleri AV19 gi|20093529||ref|NP_613376.1| CBS-domain-containing protein [Methanopyrus kandle protmod 134 ....DAREVMSTPVITIHENDTIAKARAIMRDHGISRLPVVNDANKLRGIVTTTDIIREVIKPITRLGKM--DRKGEKVPAFGHPVKNIMSSPVRAEPDETVVDLCEKIVEHGIRGMPIVNKLEEPIGVVTRRDILRKI...... 267
389  2.000e-17 14  Polaromonas sp. JS666 gi|54031627||ref|ZP_00363760.1| COG0516: IMP dehydrogenase/GMP reductase [Polaro protmod 84 .KVKRYESGVLRDPVVITPTHTVRQVMALSEQLGISGFPVIDG-GRVVGIVTGRDMRF--------------------ESRMDVPVSTIMTPLITISETASLADAKALLNKHRLERVLLVNDNFELKGLITVKDITK........ 201
390  2.000e-17 23  Geobacter sulfurreducens PCA gi|39997108||ref|NP_953059.1| CBS domain protein [Geobacter sulfurreducens PCA] protmod 3 ....KVGTWMTKNPVTIEKDATVIEAVHLMKEKSIRRLPVMDKE-TIVGILTEKMVADFRPSKATSLDTWEVHYILS-----KTSVTEAMPKPYKVKPDTDLTEAAQLLHDRKLNGVLVVDDNDRLVGILTVTNALEALIEICK. 137
391  2.000e-17 22  Burkholderia cepacia R18194 gi|46313926||ref|ZP_00214514.1| COG0517: FOG: CBS domain [Burkholderia cepacia R protmod 3 ....RVNEIMSQDVVRIAPTDSIRHAAQLMERYDVGALPVCD-NNRLVGMVTDRDL---------------AVRAISAGKPPETRIQEVASGPIWCFEDDSLDEIQHYMADAQLRRLPVVDHDKRLVGMLSLADI.......... 118
392  2.000e-17 23  Sulfolobus tokodaii str. 7 gi|15921048||ref|NP_376717.1| hypothetical protein ST0813 [Sulfolobus tokodaii s protmod 75 ...KDVKYVMTPNPVYVYENDDVLDALTLMVARNFGSLPVVNEVKKVTGIVTEREMLLIFQDLDQLF-----------------SVKKFMTKRVTVYEDVSVFDATKLMIKRGFRRLPVINESGEVIGIITAADSLKLLTK.... 196
393  2.000e-17 21  Bradyrhizobium japonicum USDA 110 gi|27377873||ref|NP_769402.1| hypothetical protein blr2762 [Bradyrhizobium japon protmod 7 ...QTVDGYMTRNVKTVQRDIDMLELSEMFERDDFNSYPV-EDDGQVVGIVTKFDILKCFAFTPSQMLPRY-------HDLMSRKIGDVMTPEIYVSPDTRLTRVLQIMVEHRIRSIIVLDGAQKLVGIIAREDVIAAL...... 135
394  2.000e-17 25  Deinococcus radiodurans R1 gi|6458717||gb|AAF10565.1| acetoin utilization protein, putative [Deinococcus ra protmod 3 .....VSDWMTRTPVTVTPDTPVMDALKLISE-RRVRRLPVLRDGKLVGITTRKDLKDAMPSKATTLSVWELNYLLS-----KLTVEEIMGRPVTAQEDEYMEDAALRMQEHKFGGLPVLNAQGQMSDIITTSDVIRA....... 130
395  2.000e-17 23  Corynebacterium efficiens YS-314 gi|23493223||dbj|BAC18194.1| conserved hypothetical protein [Corynebacterium eff protmod 155 ....RLGEFKINNPISVGPGTSIREAAQTMERYAVSSLLI-QTDGELIGIATDRDMRGRVVAAALD---------------ITQPVSTIMTNPRTATSQDLAFEAMLLMAELRIHHLPIVDE-GRISGIVTAADIMRLL...... 273
396  2.000e-17 22  Bacillus cereus ATCC 10987 gi|42783849||ref|NP_981096.1| acetoin utilization protein AcuB [Bacillus cereus protmod 3 .....VEEIMNQDVVTLHPNDTIETAIRTIRTKGIRHIPIVDQNNHVVGIISDRDVRDASPSILDEQVSL---------DMLKQPLELIMKHPVTCHPLDFVEEIATLFFENKIGCLPV-TKAGKLVGIISESTVLHTLVK.... 129
397  2.000e-17 18  Methanocaldococcus jannaschii DSM 2661 gi|15669112||ref|NP_247917.1| hypothetical protein MJ0922 [Methanocaldococcus ja protmod 5 LKNIKVKDVMTKNVITAKRHEGVVEAFEKMLKYKISSLPVIDDENKVIGIVTTTDIGYNLIRD---------------KYTLETTIGDVMTDVITIHEDASILEAIKKMKEEIINQLPVVDKNNKLVGIISDGDIIRTISK.... 136
398  2.000e-17 16  Oceanobacillus iheyensis HTE831 gi|23099677||ref|NP_693143.1| acetoin utilization protein [Oceanobacillus iheyen protmod 3 .....VEEIMKTEVITLPPKATINDALQLLQLHKIRHIPIVNDDFQVIGIVSDRDVRDASPSTFF---------EQPDIGILNNTIDSIMTKVITIHPMDFVEEIAAIFYDREIACLPVV-SNNRLIGIVTEKDMLYTLIQ.... 129
399  2.000e-17 19  Acinetobacter sp. ADP1 gi|50086461||ref|YP_047971.1| IMP dehydrogenase [Acinetobacter sp. ADP1] gi|4953 protmod 85 .RVKKFEAGMVKDPITVSPETTVRELIAITQANNISGVPVV-KDGQVVGIVTGRD--------------------TRFETNLEQPVSNIMTPLVTVKEGASKESIQALLQKHRIEKVLVVDDLHALKGLITVTDFRKA....... 203
400  2.000e-17 23  Methanosarcina barkeri str. fusaro gi|48838424||ref|ZP_00295368.1| COG2021: Homoserine acetyltransferase [Methanosa protmod 462 .....VSDIMYRNFYSVSRNETIENASTLMVKKKVNHLPVVSEDGKLEGIVTSWDITKAVACKITELDEI------------------ITRDVKYVFSGDKIETASSIMEDFSISALPVIDSENRVIGMVTSESI.......... 573
401  2.000e-17 25  Thermus thermophilus HB27 gi|46199003||ref|YP_004670.1| Mg(2+) transporter mgtE [Thermus thermophilus HB27 protmod 137 ........LMTPEYVAVREGMTVEEVLRFLRRETIYYIYVVDEKGRLKGVLSLRDLIVADPRTRVAEILNP--------------------KVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLVGIVTVDDVLDVL...... 252
402  2.000e-17 20  Sulfolobus solfataricus P2 gi|15897070||ref|NP_341675.1| hypothetical protein SSO0110 [Sulfolobus solfatari protmod 173 ....KVKNLISKKLIALKPETSLREASMIFYKEAIRGAPVINQDEKVVGILTTADIIKAFFEGNY-----------------TAKVSDYMTNVISINENEDLLDAIRKMIIYNVGRLLVLDSNNKAVGIVTRTDILRSIA..... 292
403  2.000e-17 22  Bacillus anthracis str. `Ames Ancestor` gi|47530211||ref|YP_021560.1| acetoin utilization protein acub [Bacillus anthrac protmod 3 .....VEEIMNQDVVTLRPNDTIETAIRTIRTKGIRHIPIVDQNNHVVGIISDRDVRDASPSILDEQVSL---------DMLKQPLELIMKHPVTCHPLDFVEEIATLFFENKIGCLPV-TKAGKLVGIISESTVLHTLVK.... 129
404  3.000e-17 21  Silicibacter sp. TM1040 gi|52012234||ref|ZP_00339590.1| COG0516: IMP dehydrogenase/GMP reductase [Silici protmod 83 .RVKRFESGIVYNPITLRADQTLADAKALQERYRVTGFPVVDDSGRVVGIVTNRDMRFASDDK--------------------TPVSVMMTSDNLAMLQEPAEEAISLMKARRIEKLLVTDKDGKLTGLLTLKDTEQAV...... 202
405  3.000e-17 19  Methylococcus capsulatus str. Bath gi|53756187||gb|AAU90478.1| inosine-5`-monophosphate dehydrogenase [Methylococcu protmod 85 ..VKKYESGVIKEPITVPPTATIREVMELTRARNISGVPVVDG-GELVGIVTSRDLRFETR--------------------YEEPVTRAMTPKVTVQEGSSKEEAIRLLHQHRIEKVLIVNEAFQLRGMITVKDIQK........ 201
406  3.000e-17 22  Symbiobacterium thermophilum IAM 14863 gi|51893768||ref|YP_076459.1| glycine betaine/carnitine/choline ABC transporter protmod 250 ....TVADVMIPDPVTAGPEYGIAEAVATMRRRRVNSVLVVDGDGRLLGIVTARAVERGLASH--------------------RTLGEIMTRLTTVLPHQPVTHAVQRMLLERLEFLPVVDEQGRLQGLVTNTSLVGTLSR.... 367
407  3.000e-17 25  Methanothermobacter thermautotrophicus str. Delta H gi|15679286||ref|NP_276403.1| inosine-5`-monophosphate dehydrogenase related pro protmod 1 MSNKAVRDYMTRDVITVSSDTSTAEIIKLMKETGHDGFPVKD-NGSVIGMVTAFDL---------------------LIKPWVKTVSEIMSDVVVADQDMSLNDAARVMFRMGISRLPVINKEGKLVGIITNTDIVR........ 117
408  3.000e-17 20  Silicibacter pomeroyi DSS-3 gi|56678645||gb|AAV95311.1| inosine-5`-monophosphate dehydrogenase [Silicibacter protmod 83 .RVKRFESGIVYNPVTLRPDQTIADAKALVERYNFTGFPVTDTRGHIVGIVTNRDMRFATSDDM--------------------PVSAVMTDLAMLAEPADLDEAKSLMRARRIEKLLVHDGQGRLTGLLTLKDTEQAV...... 202
409  3.000e-17 17  Mus musculus gi|33867941||gb|AAQ55224.1| AMP-activated protein kinase gamma 2 non-catalytic s protmod 191 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSKLETLENIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 322
410  3.000e-17 28  Sulfolobus tokodaii str. 7 gi|15922703||ref|NP_378372.1| hypothetical protein ST2371 [Sulfolobus tokodaii s protmod 3 .....VSQLITKKPVIASKDISIREAAKIMKKEEVGSLVIVDKDYKAIGIVTERDLLYAIADEI----------------PLDKPVSEIMSNPVTIEENSDISEAVALMTSREIRHLIVVDHDGKVKGVISIRDVARAV...... 121
411  3.000e-17 18  Magnaporthe grisea 70-15 gi|38105711||gb|EAA52104.1| hypothetical protein MG03699.4 [Magnaporthe grisea 7 protmod 100 .KVKRYENGFILDPVVISRDTTVGEAKALKEKWGFGGFPVTETGKKLLGIVTNRDI--------------------QFEDDVNTKVADVMTDLITAPSGVTLAEANKILAKSKKGKLPIVDQDFNLVSMISRSDLNKNL...... 221
412  3.000e-17 18  Aeropyrum pernix K1 gi|14600549||ref|NP_147066.1| hypothetical protein APE0231 [Aeropyrum pernix K1] protmod 4 ....RVVSYMTRDVYTVSPDDTLAHARKLMLTHDISRLPVV-EGSKLRGIITITDIADALVRKY------------PSRPANSIYVREVMRDVVTIEGTKSVKTAASLMLKHNIGGVPVVAPDGTLEGIITRTDLTRYYSEKMK. 131
413  3.000e-17 20  Ehrlichia canis str. Jake gi|46308908||ref|ZP_00211100.1| COG0516: IMP dehydrogenase/GMP reductase [Ehrlic protmod 81 .KVKKYESWIVYNPIAVSPDDSLAVALSIMEEYSYSGIPVVTENGKLVGILTNRDVRFIEDKGC--------------------KVADIMTKLITVPEGIERADAIKLLHQYRKERLIVVDNNYCCVGLITVKDIEK........ 201
414  3.000e-17 23  Geobacillus kaustophilus HTA426 gi|56419625||ref|YP_146943.1| hypothetical protein GK1090 [Geobacillus kaustophi protmod 2 ...QTVRDVMSTDVQYCTPLDNLYEAAVKMRDFNVGAIPIID-DGRLVGMITDRDIVVRGMAE---------------KRPGSTAVTEVMSDLVTLSPDDSVQKAADMMARHQIRRLPVV-ENGRLVGIISLGDL.......... 117
415  3.000e-17 16  Canis familiaris gi|57095936||ref|XP_532435.1| PREDICTED: similar to RNA binding motif protein 28 protmod 293 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKIRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDRDELVAIIARTDLKK........ 416
416  3.000e-17 18  Bacillus subtilis subsp. subtilis str. 168 gi|16080022||ref|NP_390848.1| acetoin dehydrogenase [Bacillus subtilis subsp. su protmod 3 .....VEQIMKRDVITLTKTDTLETAICKLKEFHIRHLPVVDEERHVIGMITDRDMKQAS-PSIFEENKRSLFLTRSVDSIMKKDV-------VCAHPLDFVEEISAVFYEHGIGCLPVV-HHQKLIGILTKTDLLRTFVK.... 129
417  3.000e-17 22  Methanothermobacter thermautotrophicus str. Delta H gi|15679235||ref|NP_276352.1| inosine-5`-monophosphate dehydrogenase related pro protmod 111 .....VKSIMTRDVISITTRDSIADAVSMMLENSVGALPVVDDDEKIAGIVSERDFVLLMAGVFNDEVTEEHMTA----------------DVISTTPGTPIEGASKIMVRNRLRRIPVLGEERKLVGIVTSTDILEFLGRNQ.. 240
418  3.000e-17 20  Moorella thermoacetica ATCC 39073 gi|49237280||ref|ZP_00331335.1| COG1125: ABC-type proline/glycine betaine transp protmod 246 LELRTVEQVMIGEPVTVRPHTGVAEGVATMRRKKVDTLLVTDESGRLLGAVSIEELNRNYQRAH--------------------QVQDLMRDVPVVFEGTPAREAFDLITRERLEYLPVIDKEGRLKGLVTRTSMVNALA..... 366
419  3.000e-17 23  Moorella thermoacetica ATCC 39073 gi|58425506||gb|AAW74543.1| polysialic acid capsule expression protein [Xanthomo protmod 400 .....ITDVMHDDLPRVREDASLSEALMEMSRKRLGMTAVVDNDERLIGLFTDGDLRRALDSDI---------------DVRSAGIAQVMTNPRTIGADQLAAEAARLMEDYKINGLIVVDAQQRAVGALNIHDLLRA....... 520
420  3.000e-17 19  Thermoplasma volcanium GSS1 gi|13542143||ref|NP_111831.1| CBS domain-containing protein [Thermoplasma volcan protmod 2 ....RVEKIMNTNYRSVNENSSVFDAVKIMNENRLYGLIVKDNEGKDVGLISERSIIKRFIPRN--------------KKPDEVQIKYVMRKPIKVPSSYDVRDAAAYLSENGLERCAVVDSTGKVVGIITLTDLSRYLSR.... 125
421  4.000e-17 20  Bordetella parapertussis 12822 gi|33595927||ref|NP_883570.1| inosine-5`-monophosphate dehydrogenase [Bordetella protmod 84 .RVKRHEFGIVIDPVTVTPDMKVRDAIALQRQHGISGLPVV-EGRKLVGIVTNRDLRF--------------------EDRLDQPLRNIMTPLVTMKEGATLDEAQALMHKHRLERVLIVNDAFELRGLATVKDIVK........ 201
422  4.000e-17 22  Dechloromonas aromatica RCB gi|41722897||ref|ZP_00149863.1| COG0517: FOG: CBS domain [Dechloromonas aromatic protmod 12 ..........NRPLAVVAPSDTVYHALTVMAQHEVGALLVLDGE-QLVGIFSERD--------------YARKIILQGKTSKETLVREIMSDRVYVTPGSTLDECMALMTEKRFRHLPVLDEQGGIVGMISIGDLVKETISDQK. 131
423  4.000e-17 19  Methanocaldococcus jannaschii DSM 2661 gi|15669410||ref|NP_248220.1| hypothetical protein MJ1225 [Methanocaldococcus ja protmod 150 .....IDDYITRDVIVATPGERLKDVARTMVRNGFRRLPVVSE-GRLVGIITSTDFIKLLGSDWAFNHMQTG----NVREITNVRMEEIMRDVITAKEGDKLKKIAEIMVTNDIGALPVVDENLRIKGIITEKDVLKYFA..... 280
424  4.000e-17 17  Methanosarcina mazei Go1 gi|21227405||ref|NP_633327.1| hypothetical protein MM1303 [Methanosarcina mazei protmod 199 .TNKTVDEYMTKNVTMVTTDTTIGQAAKVMVQNRFRRLPVV-KDGIFAGIVTASDIVHFMGKGDA----FSKLTTGNIHEALDQPVGSIISKEIWTSPGTDMGKAMEIMLEKKIGSLPIL-EEGMLRGIITESDFLR........ 329
425  4.000e-17 16  Rattus norvegicus gi|34576559||ref|NP_908940.1| protein kinase, AMP-activated, gamma 2 non-catalyt protmod 191 ...........HNIAFIHPNTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 322
426  4.000e-17 20  Saccharomyces cerevisiae gi|729848||sp|P38697|IMD2_YEAST Inosine-5`-monophosphate dehydrogenase IMD2 (IMP protmod 113 .RVKNYENGFINNPIVISPTTTVGEAKSMKEKYGFAGFPVTTDNAKLVGVITSRDIQFVEDNSLL--------------------VQDVMTNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMK........ 232
427  4.000e-17 19  Methanosarcina acetivorans C2A gi|20093428||ref|NP_619503.1| hypothetical protein MA4649 [Methanosarcina acetiv protmod 199 .TNKTVDEYMTKNVTMVTTDTPIGQAAKVMVQNRFRRLPVV-KDGIFAGIVTASDIVHFLGRGDA----FSKLTTGNIHEALDQPVGSIVSQEIWTSPGTDMGKAMEIMLEKKIGSLPVL-EDGMLRGIITESDFLR........ 329
428  4.000e-17 19  Magnetospirillum magnetotacticum MS-1 gi|23013062||ref|ZP_00053012.1| COG2905: Predicted signal-transduction protein c protmod 18 ....RLREVMSAPVLTALASVTLHDAVHRMYESRVSSIVGVDAEGRTLGIFTERDLLRILSTNGPAGLE--------------QTLDQTMTKPVTVPADAYVYVALARMTRLGLRHLVVVDDDKRPLGMITGRALLK........ 137
429  4.000e-17 19  Mesorhizobium loti MAFF303099 gi|13476736||ref|NP_108305.1| hypothetical protein mll8143 [Mesorhizobium loti M protmod 237 ......RDIMSRDVVSVREQATADEARQQLLDHNIRTLPVVDAEARLVGAVGLRELTKAP-----------------------DTVKGVMSKAGTASPETPAMSLLPVLTDGRSHAVVIVDGERHILGLITQTDLLAAAARVQ.. 350
430  4.000e-17 18  Gallus gallus gi|53132783||emb|CAG31936.1| hypothetical protein [Gallus gallus] protmod 193 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCSMLETLETIVDRIVKAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 324
431  4.000e-17 22  Pyrococcus furiosus DSM 3638 gi|18976459||ref|NP_577816.1| inosine-5`-monophosphate dehydrogenase related pro protmod 1 MKA-PIKVYMTKKLIGVTPDTTVQEASKLMMEFEIGSLVVIDEKGNVIGFFTKSDILRRVVVPGLPY---------------DTPVKDIMTKEITVNSNTPLGEVLRKMARHRIKHILI-EEEGKIVGIFTLSDLLEA....... 122
432  4.000e-17 22  Idiomarina loihiensis L2TR gi|56460527||ref|YP_155808.1| Signal-transduction protein [Idiomarina loihiensis protmod 151 ....TVDTIITREPVSIDLNASIHDAAAKMTDEKVSSLLIIDETQHLVGIITDKDLRKRVL---------------AVNRSSTHPVSSIMTENLTVQHNNRVFEALLIMMRTNLHHLPVL-KKGQVVGVIALSDVAQHESK.... 273
433  4.000e-17 18  Oryza sativa (japonica cultivar-group) gi|38347506||emb|CAE02417.2| OSJNBa0095E20.4 [Oryza sativa (japonica cultivar-gr protmod 101 ....KLGEVMSRLVQVAMADQRLADIDAFFAAQ--SGLPVLDEEGRCIGVISKKDKAKASNG-------------------LDSTVGEVMSSPITLTPEKTVLEAAALMLKEKVHRIPVVNEQQQVIGIVTRTDVFKALEASK.. 219
434  5.000e-17 17  Schizosaccharomyces pombe gi|2239243||emb|CAB10161.1| SPBC2F12.14c [Schizosaccharomyces pombe] gi|7492668| protmod 113 .KVKKYENGFILDPVVFSPQHTVGDVLKIKETKGFSGIPITENGGKLVGIVTSRDV--------------------QFHKDTNTPVTEVMTPLITTAEGISLERANEMLRKSKKGKLPVVDKDDNLVALLSLTDLMKNL...... 236
435  5.000e-17 15  Drosophila melanogaster gi|24648659||ref|NP_732600.1| CG17299-PE, isoform E [Drosophila melanogaster] gi protmod 603 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 719
436  5.000e-17 26  Archaeoglobus fulgidus DSM 4304 gi|11498576||ref|NP_069804.1| hypothetical protein AF0971 [Archaeoglobus fulgidu protmod 144 ....RVGELISKKPVVCSPYTSIRDAAIKMELNGVGSIVVVDDNLKPLGILTSKDF----------------RTFIIYGKSHQEKVSAYMTSPVVVDYSTPVFEAHLELLKRGINHL-VVTENGKVRGVITANDIL......... 259
437  5.000e-17 20  Burkholderia cepacia R1808 gi|46324289||ref|ZP_00224650.1| COG0517: FOG: CBS domain [Burkholderia cepacia R protmod 3 ....RVNEIMSQDVVRIAPTDSIRHAAQLMERYDIGALPVCD-NNRLIGMVTDRDL---------------AVRAISAGKPPETRVHEVASGPIWCFVDDSLDEIQHYMADAQLRRLPVVDHDKRLVGMLSLADI.......... 118
438  5.000e-17 15  Methanothermobacter thermautotrophicus str. Delta H gi|15678875||ref|NP_275992.1| inosine-5`-monophosphate dehydrogenase related pro protmod 389 .....VRELESKPVIITHQEDDLKDVARKMVDNNINHIPVVDSEGVLRGIVTSWDIADAVARG-------------------KRKLRDIMTRKVVVRENEPVDVVARRIDKYNISGLPIVDDENRVKGIVTAEDISRLIGKVDKR 510
439  5.000e-17 15  Drosophila melanogaster gi|27228270||gb|AAN85720.1| loechrig isoform VII [Drosophila melanogaster] gi|27 protmod 603 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 719
440  5.000e-17 23  Thermus thermophilus HB27 gi|46199252||ref|YP_004919.1| hypothetical protein TTC0950 [Thermus thermophilus protmod 242 ....KVKDLMTPNPIVLPPDLPVEEALALALRHKVSGFPVVAE-GRLLGVVGLEGLEGANPLD---------------------PVARHLLPPLLLSPEEDALTALERMAERGYARALVVEGD-RLLGVLSKTDLLRA....... 352
441  6.000e-17 25  Pyrococcus furiosus DSM 3638 gi|18978199||ref|NP_579556.1| hypothetical protein PF1827 [Pyrococcus furiosus D protmod 1 MKVKT---IMTPNPVTITLPATRNYALELFRKHKVRSFPVVNKEGKLVGIISIKRVLTNVDEEQLAML--------------------VKRDVPTVKPDDTLKKAAKLMLEYDYRRVVVIDEEGKPVGILTVGDIIRYLAKSEK. 122
442  6.000e-17 19  Danio rerio gi|41393093||ref|NP_958872.1| IMP (inosine monophosphate) dehydrogenase 2 [Danio protmod 106 .KVKRYEQGFITDPVVMSPNERVRDVFQAKARHGFCGIPITDNGGRLVGIISSRDI---------------DFLKESEHDL---PLSEVMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNEEGCLVAIIARTDLKK........ 229
443  6.000e-17 16  Mus musculus gi|30350876||gb|AAP22981.1| AMP-activated protein kinase gamma subunit [Mus musc protmod 357 ...........RDLAVVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 478
444  6.000e-17 20  Methanocaldococcus jannaschii DSM 2661 gi|15669594||ref|NP_248407.1| hypothetical protein MJ1404 [Methanocaldococcus ja protmod 130 MKDTKVTKIMTRNVITINENDSIGKARALMRDNNIGRLVVVDDEGNPVGMVTEVDILKKVFKPKKKMTAGEFKGEKVPR--MGQPVRLIMTPLITVDVDASAADAARVMQEYDIRGVPVVKGK-SLRGIVTRLDIIKYIADLKK. 271
445  6.000e-17 19  Haloarcula marismortui ATCC 43049 gi|55379374||ref|YP_137223.1| hypothetical protein rrnAC2755 [Haloarcula marismo protmod 271 ....TVADVMTPHVTTVADDMSVRELIQTMFRERHTGYPV-KRSGEVVGLVTLEDARAVQEVEREAY-----------------TVGDVMTTEITISPETDVMDALTSLQQNSVGRLLVTDEDGSFEGLLTRSDIMTALS..... 391
446  6.000e-17 15  Drosophila melanogaster gi|24648655||ref|NP_732598.1| CG17299-PF, isoform F [Drosophila melanogaster] gi protmod 1097 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL.........1213
447  7.000e-17 17  Tetraodon nigroviridis gi|47220485||emb|CAG03265.1| unnamed protein product [Tetraodon nigroviridis] protmod 107 .KVKRYEQGFITDPVVMSPNERVRDVFQAKARHGFCGIPITDNGGKLVGIISSRDIDFLKEEDHD------------------LPLNEVMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNEQGSLVSIIARTDLKK........ 230
448  7.000e-17 16  Acinetobacter sp. ADP1 gi|50086256||ref|YP_047766.1| conserved hypothetical protein; putative membrane protmod 238 ......RDIMTKDVITLYQEDDIHQSLDKFKHVNLMSLPVIDAEQQLVGTLALYDVVEWFKRAADPRAPWEFM------------VKQIMRKVVTVNPEQPIQDLVPYFVEKSFNYIPVL-EKEKLVGIISRADMIAALQQQ... 361
449  7.000e-17 23  Pyrobaculum aerophilum str. IM2 gi|18313720||ref|NP_560387.1| conserved protein with 2 CBS domains [Pyrobaculum protmod 12 ....RVSDIMVKNVITAKENEKIRDIAIKMYENRVGSVVIIDDEGKPIGIVTERDMVYVLARALPP----------------DTPAWMVMTNPVVINENALVIEAMDKMRELNIRHLPVVDQSGKVVGMVSFRDIV......... 128
450  7.000e-17 20  Pseudomonas putida KT2440 gi|26986946||ref|NP_742371.1| CBS domain protein [Pseudomonas putida KT2440] gi| protmod 2 ...KTVEQILKTKVYTIGPDDSVLDALKLLAEKNIGALPVV-EGGQVVGIVSERD--------------YARKLVLKGRSSAATPVREIMSAPVTVEPKQKLDFCMNLMTDRHLRHLPVVD-NGRLLGLLSIGDLVKE....... 126
451  8.000e-17 18  Arabidopsis thaliana gi|21592917||gb|AAM64867.1| unknown [Arabidopsis thaliana] protmod 262 ........IMSKDIIKIYEDEPVLQAFKLMRRKRIGGIPVIERNSKPVGNISLRDVQFLLTAPEIYHDYRSITTKNSVREHLEKTSAPIMSGVIACTKNHTLKELILMLDAEKIHRIYVVDEFGNLEGLITLRDIIARL...... 400
452  8.000e-17 20  Shewanella oneidensis MR-1 gi|24372818||ref|NP_716860.1| acetoin utilization protein AcuB, putative [Shewan protmod 5 .....IADIMCTRVVTVEMDDRLTVAKDIFEQANFHHLLVLDEY-KLEGVLSERDLLRAISPNLGNGAETSKDLET-----LQKRIHQVMTNPVTVAPYVSLDVASRTLLEHNIGCLPVL-ENGDLVGIVTWKDLLRAYCAHNE. 137
453  8.000e-17 19  Methylococcus capsulatus str. Bath gi|53758709||gb|AAU93000.1| sugar isomerase, KpsF/GutQ [Methylococcus capsulatus protmod 208 .....VRDIMHTDTPVIGLEASVRDALLEMTAKKLGMTAIVDGAGTIQGVFTDGDLRRLL---------------EKAQDIHATPITAVMTSCVTVEGSLLAAEAVRIMEQKRINALPVV-ENGRLIGAINMHDLLRA....... 327
454  8.000e-17 19  Bacillus halodurans C-125 gi|10176366||dbj|BAB07461.1| BH3742 [Bacillus halodurans C-125] gi|15616304|ref| protmod 171 ..IRRIQDVMTEPAVTVQEQALVQEVARKMMDEGTSSVIVLNDENKLSGIITEKDLVGRVIAS---------------GQSKTQKAYEVMTNPYTISRHAYYYEAMSMFLMNKIKHLPV-EEAGRPLGMVTLSDLLQ........ 290
455  8.000e-17 16  Sus scrofa gi|37956594||gb|AAP14907.1| AMP-activated protein kinase gamma subunit [Sus scro protmod 382 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNETGQVEGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGV-------LSCQPHETLGEVIDRIVREQVHRLVLVDETQHLLGVVSLSDILQAL...... 502
456  8.000e-17 16  Coxiella burnetii RSA 493 gi|29654639||ref|NP_820331.1| inosine-5`-monophosphate dehydrogenase [Coxiella b protmod 84 .KVKKFESGVVFDPITVSPESTIGELKKITSEYNISGLPVVEGE-QLIGIITSRDIRFETD--------------------MQQKVVNLMTPKITIKEGASRDEIINLFRQHRVEKLLVINDRFELRGLITVKDILR........ 201
457  9.000e-17 21  Moorella thermoacetica ATCC 39073 gi|49235037||ref|ZP_00329114.1| COG0517: FOG: CBS domain [Moorella thermoacetica protmod 3 .....ARDIMTTNVITITPSARIYELTRLLAEKQISGVPVCDGDNHVVGIVGEADLLGLVNGHL---------------------VRDIMSQPVIVDAEDPVEKVAAILHEKRIKRVPVY-SNGRLVGIISRADIVAAMARENK. 120
458  9.000e-17 20  Thermococcus kodakaraensis KOD1 gi|57159145||dbj|BAD85075.1| Voltage-gated chloride channel protein [Thermococcu protmod 445 .....VGEIMSRDPVYVTKDMTLFDVEHLIGETAHDCFPVVDENLNVVGIIGIKDILKK----------PSSVKRLKVERFLNRAYA-------VTYPTETAEAAFEKLMAYDQNLLPVVESNRRLVGVVTKRDIYRAYYRGLE. 568
459  1.000e-16 17  Streptococcus mutans UA159 gi|24378033||gb|AAN59303.1| putative acetoin utilization protein, acetoin dehydr protmod 3 .....VKDFMTRRVVYISPDTTVAKATDIMREKNLRRLPVI-ENDVLVGLLTEGTIADANPSKATSLSIYEMNYLLNKTKARDVMIKDV----ITVSKDDRLEDAIYIMMKHKIGVLPVVDGN-QMSGIITDKDVFRAFLE.... 132
460  1.000e-16 23  Methanococcoides burtonii DSM 6242 gi|53731199||ref|ZP_00349089.1| COG1994: Zn-dependent proteases [Methanococcoide protmod 195 .....VKDVMSKDVIFVEPSMTIDELTQFMFEKKHMGYPVMERN-TLKGIITFTDVRRVMSLERYSVL-----------------VSDAMTDVVTIPLEANAADAFKLMSFNKIGRVLVIDEGGSVTGILSRTDLMHTM...... 311
461  1.000e-16 18  Methanosarcina mazei Go1 gi|21227404||ref|NP_633326.1| hypothetical protein MM1302 [Methanosarcina mazei protmod 128 ...KTIEAIMTKKVKTCSPDERVSKVWNYMIETDYTGIPVVSKKGDPIGMITRRDIIKS------GALRMAIEDERATRPNESPKVEKIMSTPYTLSENDSIKSAIDIIVQRDIGRITVVNEQGKISGIADRQDLLESVVKG... 261
462  1.000e-16 22  Pyrobaculum aerophilum str. IM2 gi|18313646||ref|NP_560313.1| conserved protein with CBS domains [Pyrobaculum ae protmod 36 ...........RELITIGPEKTLKEAVDLMVKYNIGFLPVV-EGGKLLGVLSESDVMRLVAQGVD----------------LNTPISVYMTKPITVSKQSTLREAAELMVKHNIRHLPVI-EDGKVVAVLSVKDIVKVI...... 146
463  1.000e-16 24  Symbiobacterium thermophilum IAM 14863 gi|51893134||ref|YP_075825.1| hypothetical protein STH1996 [Symbiobacterium ther protmod 2 ....RLRDLMTTDVRTCAPDTPVSEVARIMEEADCGFVPVVDG-GRVAGVITDRDIVL--------------RAVARGRDIRTTTARECMTSPVTVGPDTDAHAAADLMADKQIRRLCVVDG-GRLVGVVALGDL.......... 117
464  1.000e-16 17  Tetraodon nigroviridis gi|47229572||emb|CAG06768.1| unnamed protein product [Tetraodon nigroviridis] protmod 204 ...............VVRADTPLYTALGIFVEQRVSALPVVDDRGRVVDIYSKFDVINLAAEKTYNNLDVTVTKALQHRSQYFEGV-------LTCNRDDTLETIINRLVEAEVHRLVVVDEQEVVRGIVSLSDILQAL...... 320
465  1.000e-16 23  Aspergillus nidulans FGSC A4 gi|40743619||gb|EAA62809.1| hypothetical protein AN5716.2 [Aspergillus nidulans protmod 119 ................IKPSTTIAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGL--------------KARDITVSEIMTNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVL---DITKCFYDAMEK 231
466  1.000e-16 19  Aspergillus nidulans FGSC A4 gi|58417120||emb|CAI28233.1| Inosine-5`-monophosphate dehydrogenase [Ehrlichia r protmod 81 .KVKKHESWIVYNPIAVSPEDSLAVALSIMKKYSYSGIPVVTETKRLVGILTNRDVRFVENKDC--------------------KVADIMTKLITVPEGIERCDAIKLLQKYRKERLIVVDNNYCCVGLITVKDIEK........ 201
467  1.000e-16 19  Oryza sativa (japonica cultivar-group) gi|51979508||ref|XP_507550.1| PREDICTED OJ1136_C12.20-2 gene product [Oryza sati protmod 89 .RVALLSEAMSAPVLVATAEQTLEEVECHF--ETVSGLPVIDASLRCVGVIVKSDRARASHGS-------------------KTKIAEVMTSPITLPSDKTVMDAAALMLKKKIHRLPIVNQDRQVIGIVTRADVLREL...... 206
468  1.000e-16 21  Saccharomyces cerevisiae gi|456156||gb|AAC09509.1| Yar073wp [Saccharomyces cerevisiae] gi|731323|sp|P3956 protmod 113 .RVKNYENGFINNPIVISPTTTVGEAKSMKEKYGFAGFPVTADNAKLVGAITSRDIQFVEDNSLL--------------------VQDVMTNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMK........ 232
469  1.000e-16 22  Sulfolobus tokodaii str. 7 gi|15921004||ref|NP_376673.1| hypothetical inosine-5`-monophosphate dehydrogenas protmod 69 ....KAKDLMSEDLISVTPDTPVIDAIKIMINNNIGGLPVV-ENQVIRGLFTEREVINVIANLKFSGI-----------------VDSIMSTKITIPQNSTILEAAKIMAMRGIRRLPIVNEY-RMVGIITAADIVKYLEKHR.. 189
470  1.000e-16 13  Caenorhabditis briggsae gi|39584008||emb|CAE66414.1| Hypothetical protein CBG11682 [Caenorhabditis brigg protmod 174 ............DILCCHVDTPIHDALELFLKNRVSALPLIDEHGRVVDIYAKFDVISLAAENSYDKLDCTVQEALKHRSEWFEGV-------HTCQATDSLFQVLEAIVKAEVHRLIVTDQDRKVVGVVSLSDILKYL...... 293
471  1.000e-16 19  Methylobacillus flagellatus KT gi|53759420||ref|ZP_00172244.2| COG0517: FOG: CBS domain [Methylobacillus flagel protmod 1 .........MTPDPVTVQPETPVDDIARLLLAHRING-PVIEGAGRLIGVVTAEDLIHRGADERLEPRESVWKENTQRDKAGGRTAAEVMTTEVSVAAAMHPSVAARLMVDHHLTSLPVV-EDGKVIGVISRIDLLSLLKE.... 141
472  1.000e-16 24  Ralstonia metallidurans CH34 gi|48770298||ref|ZP_00274641.1| COG0794: Predicted sugar phosphate isomerase inv protmod 204 .....VRDVMRTAVPAVRESTPLAQALMEITRKGMAMTAVVDPDGRAVGVFTDGDLRRLL---------------ETPRDWKTVPIGEVMRNPHTVHLDKLAVEAVQIMETNRINQLLVVDDDGHLAGALHIHDLTRA....... 324
473  1.000e-16 20  Dechloromonas aromatica RCB gi|46140973||ref|ZP_00203818.1| COG3448: CBS-domain-containing membrane protein protmod 229 ...RRVADIMTTDVISVNFGTELNEAWALLQTRHLHGVPVIDAGQRVIGVLTLENFLRHVEPDGVQGINIRRLLRKTPSIYSDKPVGQIMSERFMVQTDTPLGEVASLLADEHPSIIPVVDQRQRLAGVLTQTDLLAAIYKRQ.. 375
474  1.000e-16 22  Mesorhizobium sp. BNC1 gi|45916181||ref|ZP_00195047.2| COG0517: FOG: CBS domain [Mesorhizobium sp. BNC1 protmod 1 .........MTRDVRVASPDDTIEDAARIMAEIDAGSLPV-GDNDRLVGMITDRDIAVRAVAKGLG---------------PECPVSDVMTREIYCFEDEDTDDIAHNMADQQIRRLPVVNRDKRLVGILSLGDI.......... 111
475  1.000e-16 15  Cryptococcus neoformans var. neoformans B-3501A gi|50260638||gb|EAL23291.1| hypothetical protein CNBA4070 [Cryptococcus neoforma protmod 124 .RVKKYENGFITDPLCLGPDATVGDVLEIKAKFGFCGVPITEPNSKLLGIVTGRDVQFQDAE---------------------TPIKSVMTTVVTGSSPITLEKANSLLRETKKGKLPIVDSNGHLVSLVARSDLLK........ 242
476  1.000e-16 23  Methanothermobacter thermautotrophicus str. Delta H gi|15679235||ref|NP_276352.1| inosine-5`-monophosphate dehydrogenase related pro protmod 175 ......EEHMTADVISTTPGTPIEGASKIMVRNRLRRIPVLGEERKLVGIVTSTDILEFLGRNQAFSAMKT----NSAEEVLSTPVNEIMTQVCMVTSTTPLGRVCELMEEHGIGGLPVVD-YGELTGIITESDLLRAIA..... 312
477  1.000e-16 15  Drosophila melanogaster gi|24648661||ref|NP_732601.1| CG17299-PG, isoform G [Drosophila melanogaster] gi protmod 511 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 627
478  1.000e-16 18  Thermotoga maritima MSB8 gi|15643608||ref|NP_228654.1| hemolysin-related protein [Thermotoga maritima MSB protmod 208 MKQIAVKEIMTPDIVAIEENQTVKDLIELVEDEGYSRIPVYKETDNIVGICYAKDVLSMLA-------------EKDCEEVKSMKVKDIMREALYVPETMNIDELLKILKARKIHIAIVVDEYGGTAGIVTLEDIIEELFGN... 339
479  1.000e-16 18  Vibrio parahaemolyticus RIMD 2210633 gi|28898499||ref|NP_798104.1| hypothetical protein VP1725 [Vibrio parahaemolytic protmod 147 LTTAKARKILTRDPVTLEATASIQEAASLMAEENVTALLIVEDDDQLLGILTDRDLCIRVLAQGID---------------TNILVSEVMSDVVSLDYNAYVFEAMLTMLRYNVHHLPIL-KDKKPIGIIGMTDIVRYESQN... 281
480  1.000e-16 21  Streptococcus pneumoniae TIGR4 gi|15900649||ref|NP_345253.1| acetoin utilization protein AcuB, putative [Strept protmod 3 .....VKDFMTRKVVYISPDITVSHAADLMREQGLHRLPVI-ENDQLVGLVTEGTIAQASPSKATSLSIYEMNYLLN-----KTKVKDVMRDVVTVSGYASLEDATYLMLKNKISILPVVD-NHQVYGVITDRDVFQAFLE.... 132
481  1.000e-16 16  Pseudomonas syringae pv. tomato str. DC3000 gi|28850936||gb|AAO54015.1| nucleotidyltransferase, putative [Pseudomonas syring protmod 154 ..NTRLGELAMRHPVMCSPDMPMRDAVKLMHEQQVGSIVIVDEQQAPLGIFTLRDLREAVA---------------DVNADFSAPVKNTMSPPFHLSPDASAFDAAIAMTGRHIAHVCLV-RDGRLCGVVSERDL.......... 271
482  1.000e-16 23  Streptococcus pneumoniae R6 gi|15902708||ref|NP_358258.1| hypothetical protein spr0664 [Streptococcus pneumo protmod 3 .....VKDFMTRKVVYISPDTTVSHAADLMREQELHRLPVI-ENDQLVGLVTEGTIAQASPSKATSLSIYEMNYL-----LNKTKVKDVMRDVVTVSGYASLEDATYLMLKNKIGILPVVD-NHQVYGVITDRDVFQAFLE.... 132
483  1.000e-16 17  Arabidopsis thaliana gi|6523084||emb|CAB62342.1| putative protein [Arabidopsis thaliana] gi|6686786|e protmod 262 ........IMSKDIIKIYEDEPVLQAFKLMRRKRIGGIPVIERNSKPVGNISLRDVQFLLTAPEIYHDYRSITTKNSVREHLEKTSAPIMSGVIACTKNHTLKELILMLDAEKIHRIYVVDDFGNLEGLITLRDIIARL...... 400
484  1.000e-16 18  Pan troglodytes gi|55620297||ref|XP_516452.1| PREDICTED: IMP (inosine monophosphate) dehydrogena protmod 246 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDCFLE------------------EIMTDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKK........ 369
485  1.000e-16 25  Pyrococcus abyssi gi|5457776||emb|CAB49266.1| Hypothetical protein, containing CBS domains [Pyroco protmod 1 MKVKT---IMTPNPVTITLPATRNYALDIFKKHKVRSFPVVNREGKLVGIISIKRVLTNPDEEQLAML--------------------VKRDVPTVKENDDLKKAARLMLEHDYRRVVVVDNEGKPVGILTVGDIVRRYLAKTEK 122
486  1.000e-16 15  Danio rerio gi|47085933||ref|NP_998326.1| zgc:63896 [Danio rerio] gi|37590253|gb|AAH59181.1| protmod 201 ............NIAVVHSDTPLYAALGIFVEQRVSALPVVDENGRVVDIYSKFDVINLAAEKTYNNLDITVTKALQHRSQYFEGV-------LTCRASETLQAIINRLVEAEVHRLVIVDEQEVVKGIVSLSDILQAL...... 320
487  1.000e-16 21  Halobacterium salinarum NRC-1 gi|15791000||ref|NP_280824.1| hypothetical protein VNG2168C [Halobacterium salin protmod 250 ....TVADVMTPDVHTVAATASVADLMDSMLEHRHTGYPVF-RDATAVGMVTLDDARSVRAVERDAM-----------------RVADVMSDDVTIPGSADATDALDALQEHSVGRLLVVDADGEMVGLITRSDLMDA....... 368
488  1.000e-16 17  Canis familiaris gi|57111209||ref|XP_545646.1| PREDICTED: similar to AMP-activated protein kinase protmod 441 ...........RDLAVVLDTAPILMALDIFVDRRVSALPVVNETGQVVGLYSRFDVI----VSVCGSGELRHLAAQQTYNHLDISVGEALKQVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 571
489  2.000e-16 18  Archaeoglobus fulgidus DSM 4304 gi|11498454||ref|NP_069682.1| hypothetical protein AF0848 [Archaeoglobus fulgidu protmod 3 .......EIATKDVFTLPPTSTLMNALKMMLRRNFRRIPIADPTKRLEGIISATDFVNIFGGGPK-FGLIKGRYGGNLSAAVNEVVETIMREVVTVNESDSLEEAVETMFEKNVGGCPIVNKDDVVVGIITERDILKYLGANR.. 139
490  2.000e-16 19  Methanococcus maripaludis S2 gi|45357970||ref|NP_987527.1| hypothetical protein MMP0407 [Methanococcus maripa protmod 9 .....VKNIMSSDVVSVSPESGVVEAFEALLKNKISCLPVVNQNNETIGIVTTTDIGYNLIIDEY---------------TLETTIADVMTKVVTIKQDESAVDALKKMDLYGINQLPVINSENKLVGILSDGDILRAISK.... 135
491  2.000e-16 19  Ehrlichia ruminantium str. Welgevonden gi|57239476||ref|YP_180612.1| inosine-5`-monophosphate dehydrogenase [Ehrlichia protmod 81 .KVKKHESWIVYNPIAVSPEDSLAVALSIMKKYSYSGIPVVTETKRLVGILTNRDVRFVENKDC--------------------KVADIMTKLITVPEGIERCDAIKLLQKYRKERLIVVDNNYCCVGLITVKDIEK........ 201
492  2.000e-16 16  Pseudomonas syringae pv. syringae B728a gi|23470428||ref|ZP_00125761.1| COG0516: IMP dehydrogenase/GMP reductase [Pseudo protmod 85 .KVKKFEAGVVKDPITIEADATVRDLFELTRMHNISGVPVL-HNGDLVGIVTSRDVRF--------------------ENRLDVPVREVMTPKVTVREGADKNEVRELLHKHRLEKVLIVDANFALKGMMTVKDIEKA....... 203
493  2.000e-16 16  Pseudomonas syringae pv. tomato str. DC3000 gi|28851895||gb|AAO54970.1| inosine-5-monophosphate dehydrogenase [Pseudomonas s protmod 85 .KVKKFEAGVVKDPITIEADATVRDLFELTRMHNISGVPVL-HNGDLVGIVTSRDVRF--------------------ENRLDVPVREVMTPKVTVREGADKNEVRELLHKHRLEKVLIVDANFALKGMMTVKDIEKA....... 203
494  2.000e-16 21  Methanocaldococcus jannaschii DSM 2661 gi|15668360||ref|NP_247156.1| inosine-5`-monophosphate dehydrogenase, putative [ protmod 1 MSVK-VSEYMTKKVVTVSKDNTVKDVIKLLKETGHNSFPVV-ENGKLIGIVSVHDI---------------------VGKDDNEKVENVMTDMVVTTPDANIMDVGRIMFRTGFSKLPVVDEENNLVGIISNMDVIR........ 117
495  2.000e-16 21  Nostoc sp. gi|25531493||pir||AD2103 two-component hybrid sensor and regulator all2379 [impo protmod 148 LKLRCVTEVMVTQIIHALPTTSVLELSQMMSDRRISCVVIVAPQETPVGMITEKDILKV---------------HLQGLDIAQTPAQTVMSSPVFISPSESLWTVNLLMQARGVRRLVVVGEQGQLQGLVTQTNLLQVL...... 275
496  2.000e-16 20  Photobacterium profundum SS9 gi|54308368||ref|YP_129388.1| hypothetical protein PBPRA1175 [Photobacterium pro protmod 4 ....KVSEYMTRKVVTIQPDTGLREAFFLMRDNAIRHLPVTNIDGELIGFISDRELRRPRWVDESPDIGHEYDLTDDLH------VADVMKDIIHVRTYDTLTKAVGTILNHSISAAPVLDKTGQLVGMLSAVDLLSA....... 132
497  2.000e-16 23  Ashbya gossypii ATCC 10895 gi|44983702||gb|AAS52801.1| AER117Wp [Ashbya gossypii ATCC 10895] gi|45190723|re protmod 112 .RVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDTGKLQGIITSRDIQFVEDETLL--------------------VSEIMTDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMK........ 231
498  2.000e-16 20  Methanococcoides burtonii DSM 6242 gi|53731223||ref|ZP_00148226.2| COG0517: FOG: CBS domain [Methanococcoides burto protmod 128 ...KVAADVMTTDIISCNPHDLLTKIWPILLTSNYSGLPVVTNADELQGMITIRDII------RFGFIRPAIGDKQQTQTKDVPSVDKIMSTPYTVLSDTSVKECVEKMLHYDVGRLTVVN-DGKVIGIVSRTDILRA....... 256
499  2.000e-16 20  Desulfitobacterium hafniense DCB-2 gi|23112704||ref|ZP_00098154.1| COG0477: Permeases of the major facilitator supe protmod 452 .........MRADPYTVSCDDNLKQVVEKFIGYKTSGLPIIDAQKHLIGFVSDGDVMRYFTKQDLRFIPDTDTLNSKARKLLSMNVMEIASNAIAVSHDTPLLEVCEIFSRRKINKLPV-TQNDILIGTISRGDIMRAL...... 589
500  2.000e-16 19  Saccharomyces cerevisiae gi|577140||emb|CAA86719.1| putative inosine-5`-monophoshate dehydrogenase [Sacch protmod 114 .KVKMFENGFINSPIVISPTTTVGEVKVMKRKFGFSGFPVTEDGGKLVGLVTSRDIQFLEDDSLV--------------------VSEVMTNPVTGIKGITLKEGNEILKQTKKGKLLIVDDNGNLVSMLSRADLMK........ 233
501  2.000e-16 21  Thermus thermophilus HB8 gi|55981285||ref|YP_144582.1| hypothetical protein TTHA1316 [Thermus thermophilu protmod 242 ....KVKDLMTPNPIVLPPDLPVGEALALALRHKVSGFPVVAE-GRILGVVGLEGLEGANPLD---------------------PVARHLLPPLLLSPEEDALTALERMAERGYARALVVEGD-RLLGVLSKTDLLRA....... 352
502  2.000e-16 20  Halobacterium salinarum NRC-1 gi|15790114||ref|NP_279938.1| GuaB [Halobacterium salinarum NRC-1] gi|10580558|g protmod 125 .RVKRADELVIDNVVTAAPEQTVEAVDEMMDRSDVSGAPVVDDDDTVRGIISATDIRPYLEVG------------------ESDAVREAMTDEVTAPEDITARDALELMYEHKIERVPIVNDEQHLVGLVTMQGILE........ 245
503  2.000e-16 17  Homo sapiens gi|41350079||gb|AAF03528.2| unknown [Homo sapiens] protmod 182 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 313
504  2.000e-16 22  Haloarcula marismortui ATCC 43049 gi|55379702||ref|YP_137552.1| MaoC family protein [Haloarcula marismortui ATCC 4 protmod 7 .....VREIMRTPVKTISPSAPVIEAAQRLRDEDIGSL-VVEDDGSCVGIITESDIVAVTAAE---------------GDTRALSVGDVMATLVTVAPDADMQAAVDRLQTNNIKKLPVV-EDGSLVGIVTTTDL.......... 120
505  2.000e-16 18  Pseudomonas fluorescens PfO-1 gi|48730246||ref|ZP_00263994.1| COG0516: IMP dehydrogenase/GMP reductase [Pseudo protmod 85 .KVKKFEAGVVKDPITIEADATVRDLFELTRMHNISGVPVL-HDGDLVGIVTSRDVRFETR--------------------LDATVREVMTPKVTVREGADKNEVRELLHKHRLEKVLIVDDKFALKGMMTVKDIEKA....... 203
506  2.000e-16 19  Leptospira interrogans serovar Lai str. 56601 gi|24212997||ref|NP_710478.1| CBS domain protein [Leptospira interrogans serovar protmod 77 .....AKDLMTSPVVSFLEDNPIKRAEEIFVQKRFRHVPVLNQKNTLCGILSDRDWMRWRLEHNPD---------------TTQTIGEIMTKILSVQIHARILEISKILFEERIGCLPIINDKIEVIGIITRSDILRAILK.... 198
507  2.000e-16 21  Pseudomonas putida KT2440 gi|26987096||ref|NP_742521.1| CBS domain protein [Pseudomonas putida KT2440] gi| protmod 180 ......GELAMRHPVVCSAHTPLREAVRLMHEQQVGSIVVVDPQRYPIGIFTLRDLRQVVA---------------TVDTDLGAAIDRHMTKPFYLPPQASAFDAAMAMTERHIAHVCLV-ENGRLCGVVSERDL.......... 293
508  2.000e-16 18  Bifidobacterium longum NCC2705 gi|23465493||ref|NP_696096.1| possible efflux transporter protein [Bifidobacteri protmod 529 .....IGGIMDDQPYSCLDSDDITHVVREFIRLNVSSLPVVNGDGRLVGFVSDGDVMKSIATGSTMVVFDDETVASKVQALSGKKVMDIATRKVVATPDQHVGEVARILAKKQFKKLPVVDGDGRLVGVIRRKSVME........ 671
509  2.000e-16 23  Burkholderia cepacia R18194 gi|46315255||ref|ZP_00215838.1| COG0794: Predicted sugar phosphate isomerase inv protmod 204 .....VRDVMRSDVPSVGLDATLSDALFQITAKRLGMTAVVDADGKVAGIFTDGDLRRVLARD---------------GDFRTLPITDVMTRPRTVAPDHLAVEAVELMERHRINQMLVVDADGVLIGALNMHDL.......... 321
510  2.000e-16 17  Homo sapiens gi|5931569||dbj|BAA84695.1| H91620p [Homo sapiens] protmod 217 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 348
511  2.000e-16 17  synthetic construct gi|30585171||gb|AAP36858.1| Homo sapiens protein kinase, AMP-activated, gamma 2 protmod 193 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 324
512  2.000e-16 20  Gibberella zeae PH-1 gi|42547611||gb|EAA70454.1| conserved hypothetical protein [Gibberella zeae PH-1 protmod 114 .KVKRYENGFINDPIVIDQNTTVGEAKALKEKWGFGGFPVTEDGKKLVGIVTNRDL--------------------QFEEDLDQAVSNVMKDLVTAPETVTLLEANKILSKSKKGKLPIVDKDSNLVSMISRSDLTK........ 233
513  2.000e-16 17  Homo sapiens gi|48257113||gb|AAH20540.2| PRKAG2 protein [Homo sapiens] protmod 206 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 337
514  2.000e-16 17  Homo sapiens gi|30583093||gb|AAP35791.1| protein kinase, AMP-activated, gamma 2 non-catalytic protmod 193 ...........HNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGV-------VKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALAKQKE. 324
515  2.000e-16 19  Chlorobium tepidum TLS gi|21673864||ref|NP_661929.1| CBS domain protein [Chlorobium tepidum TLS] gi|216 protmod 181 ...........RNVITCAPGIPIREAAKIMSENNIGSIIVVAENRHPLGIITDTDLRK--------------KVVAIAGQVNERPVSEIMTSPVTITAGKTVADMMMLMVRTKLRHFCI-TEDGTVIGIISEHDIV......... 295
516  2.000e-16 17  Rhodopirellula baltica SH 1 gi|32477176||ref|NP_870170.1| Inosine-5-monophosphate dehydrogenase [Rhodopirell protmod 131 LKVKRSANGIIVNPVTLNPAQKVSAAAELMDRANVSGIPIVEDDRTLAGILTRRDLRFLEDPDM--------------------PISQVMTNLVTAVGNVTLAQAEKILTEKRVEKLLLIDEERKLTGLITIRDI.......... 247
517  2.000e-16 18  Thermoplasma volcanium GSS1 gi|14325574||dbj|BAB60477.1| hypothetical protein [Thermoplasma volcanium GSS1] protmod 2 ......EKIMNTNYRSVNENSSVFDAVKIMNENRLYGLIVKDNEGKDVGLISERSIIKRFIPRN--------------KKPDEVQIKYVMRKPIKVPSSYDVRDAAAYLSENGLERCAVVDSTGKVVGIITLTDLSRYLSR.... 123
518  3.000e-16 15  Drosophila melanogaster gi|24648645||ref|NP_732594.1| CG17299-PA, isoform A [Drosophila melanogaster] gi protmod 644 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 760
519  3.000e-16 16  Mesorhizobium sp. BNC1 gi|45917320||ref|ZP_00196510.2| COG0517: FOG: CBS domain [Mesorhizobium sp. BNC1 protmod 3 .....IQEIMTRSVDLIDPNATIREAARKMREDNVGALPV-GENDRLIGMVTDRDI--------------TVRAVAEERSAGNTSVREVMSERVYCYEDDDAERAAAVMARHQVRRLPVINRDKRLVGIVALADLVR........ 120
520  3.000e-16 19  Thermus thermophilus HB27 gi|46198690||ref|YP_004357.1| probable hemolysin-related protein/CBS domain cont protmod 224 .....VREIMTPRVVAIEDEATLEDLLALYREHRYSRVPVYRESDHIVGVAYVQDLLTYYCEE----------------DLKAFKVASIAHPPYFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI...... 344
521  3.000e-16 16  Pseudomonas putida KT2440 gi|26987767||ref|NP_743192.1| inosine-5-monophosphate dehydrogenase [Pseudomonas protmod 85 .KVKKFEAGVVKDPITIDADATVRDLFELTRLNNISGVPVLA-NGDLVGIVTSRDVRF--------------------ENRLDAKVRDVMTPKVTVREGADKNEVRELLHKHRLEKVLIVDDKFNLKGMMTVKDIEKA....... 203
522  3.000e-16 20  Thermosynechococcus elongatus BP-1 gi|22298467||ref|NP_681714.1| hypothetical protein tlr0924 [Thermosynechococcus protmod 136 LRIKRVAEVMVCDVATIAAEASLQEAVVLMSERGVTSLVVPEETSSGVGIVTEKDIFEALHRQ---------------GGVLTGTVGSIMSQPVTVKPDQSLWQVNHLLKEHQVRRVVVVDDDGQMVGIVTQSNLLAAI...... 263
523  3.000e-16 19  Thermosynechococcus elongatus BP-1 gi|58418080||emb|CAI27284.1| Inosine-5`-monophosphate dehydrogenase [Ehrlichia r protmod 81 .KVKKHESWIVYNPIAVSPEDSLAVALSIMKKSSYSGIPVVTETKRLVGILTNRDVRFVENKDC--------------------KVADIMTKLITVPEGIERCDAIKLLQKYRKERLIVVDNNYCCVGLITVKDIEK........ 201
524  3.000e-16 17  Rhodobacter sphaeroides 2.4.1 gi|46193630||ref|ZP_00004295.2| COG0516: IMP dehydrogenase/GMP reductase [Rhodob protmod 83 .RVKRFESGIVYAPITLRPDQTLADAKALQERYNVTGFPVVDESGRVVGIVTNRDMRFANDD--------------------RTPVKVMMTNLAILQEPADRDTAISLMKARRIEKLLVTDGQGKLTGLLTLKD........... 197
525  3.000e-16 19  Thermus thermophilus HB8 gi|55980703||ref|YP_144000.1| hemolysin-related protein [Thermus thermophilus HB protmod 223 .....VREIMTPRVVAIEDEATLEDLLALYREHRYSRVPVYRESDHIVGVAYVQDL----------------LTYYCEEDLKAFKVASIAHPPYFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEI...... 343
526  3.000e-16 14  Desulfotalea psychrophila LSv54 gi|51245115||ref|YP_064999.1| related to acetoin utilization protein (AcuB) [Des protmod 20 .....IGHIMHTDLVTISPTTNLVTARKIMDSKSFDHLLVVNNRGVLEGILSDKDLKQNWASPATTLSVYELTSLLEQVQVKSIMVKTV----LTITVSTTVERAAYIMQQNNISALPVLD-NNRLAGIITSTDVMGVL...... 148
527  3.000e-16 19  Desulfotalea psychrophila LSv54 gi|58119409||gb|AAW65380.1| inosine-5`-monophosphate dehydrogenase [Candida dubl protmod 111 .KVKKYENGFINDPVVISPEVTVGEVKKMHETLGFTSFPVTENGGKLVGIITSRDI--------------------QFHEDDKSPVSEVMTRDLVVKKGISLTDGNELLRSSKKGKLPIVDDEGNLVSLISRTDLQK........ 230
528  3.000e-16 18  Canis familiaris gi|57101242||ref|XP_533835.1| PREDICTED: similar to inosine 5-phosphate dehydrog protmod 179 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKK........ 302
529  3.000e-16 19  Archaeoglobus fulgidus DSM 4304 gi|11498858||ref|NP_070087.1| inosine monophosphate dehydrogenase, putative [Arc protmod 4 ....KVKDYMTKNVYTLKPDNTVKDAIELVRKTGHDSFPVVDDNMRVVGYISAVDL---------------------LDKSPETKIRDIMSRELYVARDMDLRDAARVMFRTGHSKLPVVDEDNRLVGIISNADVIR........ 116
530  3.000e-16 21  Candidatus Blochmannia floridanus gi|33519976||ref|NP_878808.1| inosine-5`-monophosphate dehydrogenase [Candidatus protmod 85 IRVKRYESGVVTNPQCVNPDTTVLEVKERTCRNGFAGYPVVINSNELVGIVTSRDVRFVND--------------------LSIPVSDVMTPKVTVYERESRETVLAKMHDKRVEKILLVDSLFHLKGMITAKDFEKA....... 205
531  3.000e-16 26  Thermoanaerobacter tengcongensis MB4 gi|20808236||ref|NP_623407.1| CBS domains [Thermoanaerobacter tengcongensis MB4] protmod 181 MTRKKVSDVMTYNPVYMTPQQTVRDWKRLYAETKHTRFPVVDSKGMLVGMVTSRDVATASDDDRIG---------------------DIMTNPVFVTDTTTLSYAAHLMIWWNVEILPV-TRGKELIGLISREDVIKAL...... 301
532  4.000e-16 15  Drosophila melanogaster gi|27228264||gb|AAN85717.1| loechrig isoform IV [Drosophila melanogaster] gi|250 protmod 415 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 531
533  4.000e-16 20  Nostoc punctiforme PCC 73102 gi|23130557||ref|ZP_00112370.1| COG2202: FOG: PAS/PAC domain [Nostoc punctiforme protmod 148 LKLQCVTEVMVTEVIHALPTTSVLELSQIMSDRQISCVVIVAQQKAPVGMITEKDIIK---------------FHLQGLDIAQTQAQDVMSTPVSITPTESLWTVHQLMQERKVRRLTVVGEQSELQGLVTQTNLLQVL...... 275
534  4.000e-16 19  Pyrobaculum aerophilum str. IM2 gi|18313291||ref|NP_559958.1| conserved protein with 4 CBS domains [Pyrobaculum protmod 81 ...KNIIEIGTRSVISARPETPVAEVISLFLRHNFGSMPIVDEAGRLVGIFTEWDVLKLASQLDFPH-----------------RVRDVMTRIIYVTPYSTVMDVLEGITIYKFRRYPIVDENGKVVAMLHAKDVLKYFA..... 201
535  4.000e-16 21  Methanosarcina mazei Go1 gi|21227407||ref|NP_633329.1| hypothetical protein MM1305 [Methanosarcina mazei protmod 131 .....VGEVMEKYPITVSPSDRVSHARRLILDKNIGRLPVI-ENGKLVGIIAEDDIAFAMRSFRDLVADN-----QQDSRIKNLLVGDIMTSVVSVHTNTPLSDAVNTMLEHDVGGVPVLNLEEELVGFLARRNVINTIQE.... 261
536  4.000e-16 23  Candida albicans SC5314 gi|46438035||gb|EAK97372.1| hypothetical protein CaO19.12702 [Candida albicans S protmod 56 ............EPIICKPTATVYEVAQLMTARRENCVLVVNEIGELLGIFTAKDVAF--------------RIVGSGLNATQVTIDTIMTNPICANAADPAGDALNLMVERGFRHLPVLDEKSQIVGVL---DITKSYAQQMEK 172
537  4.000e-16 25  Sulfolobus solfataricus P2 gi|15897942||ref|NP_342547.1| hypothetical protein SSO1075 [Sulfolobus solfatari protmod 12 ...KRVKDFMSTPVFQVEANTSLQEVCKLMLERGVGSV-VVTEQGIPKGIFTDRDAVKA--------------IATSLSSSDEVRLAATMGNLIIVDEDIDVFEALKIMAANKIRHLPVKNKDGNIIGMFSITDVYK........ 130
538  4.000e-16 25  Picrophilus torridus DSM 9790 gi|48477542||ref|YP_023248.1| inosine-5`-monophosphate dehydrogenase [Picrophilu protmod 89 .RVKKEETIIIRDVITVDENTPVNVARTIMMTRNIAGLPVVT-SGKLSGILTKRDLEFSDNKGL---------------------VKDIMTDVVYADEDISIDEAKYILYKNRIEKLPLVDKKGRLTGLITAKDI.......... 201
539  4.000e-16 18  Anabaena variabilis ATCC 29413 gi|53765260||ref|ZP_00351645.1| COG0642: Signal transduction histidine kinase [A protmod 155 LRLRLVSEVMTCEVICAAPDSSMLAIAQLLTENRVSSVMIVNPQKIPVGIVTERDIVQFQALGL---------------NLETCQVQTVMSTPIFVRPDYSLRFVQQIMEQRLIRRLAVTGEQGELLGIVTQSSLLQAL...... 286
540  4.000e-16 26  Pyrococcus abyssi gi|5457540||emb|CAB49031.1| guaB-like2 inosine-5`-monophosphate dehydrogenase re protmod 1 MDVKAIKVYMTKKLMGVKPDTTVQEASKLMMEFDVGSLVVVDDEGNVVGFFTKSDIIRRVIVPGLSY---------------DIPVKEIMTKEITVNANTPLGDVLKKMSEHRIKHILIEDE-GKIVGIFTLSDLLEA....... 124
541  4.000e-16 21  Methanopyrus kandleri AV19 gi|20093964||ref|NP_613811.1| CBS domain-containing protein [Methanopyrus kandle protmod 146 ....RVEEIMTEDPETVPSDITVLEAAEIMVDREFRRLPVV-ENGRLCGLVTATDV-----LHHVSSMATETSPDASVEEVMDVPVEEIMTDVITIEPDVNIEEAALTMKGANVGSL-VVTEGNDVIGIITERDIMYAIAE.... 276
542  4.000e-16 18  Methanosarcina acetivorans C2A gi|20093427||ref|NP_619502.1| hypothetical protein MA4648 [Methanosarcina acetiv protmod 128 ...KTIDMVMTKKVKTCSPDERISKVWNYMTETDYTGIPVVSKKGDPIGMITRRDIIKA------GILRMSIEDERAARPNESPKVEKIMSTPYTLSENDSVKSAIEMIIQHDIGRVTIVNEQGKISGIADRQDLMNA....... 257
543  4.000e-16 21  Burkholderia fungorum LB400 gi|48786505||ref|ZP_00282639.1| COG0794: Predicted sugar phosphate isomerase inv protmod 204 .....VRDVMRTDLPKVTPEATVRDALFQLTAKRMGMTAIVDHDDHVAGIFTDGDLRRVLERE---------------GDFRQLPIASVMTAPRTIGPDQLAVEAVELMERHRINQMLVVDEAGKLIGALNMHDL.......... 321
544  4.000e-16 19  Bifidobacterium longum DJO10A gi|46190448||ref|ZP_00121474.2| COG0477: Permeases of the major facilitator supe protmod 529 .....IGGIMDDQPYSCLDSDDITHVVREFIRLNVSSLPVVNGDGRLVGFVSDGDVLKSIATGSTMVVFDDETVASKVQALSGKKVMDIATRKVVATPDQHVGEVARILAKKQFKKLPVVDGDGRLVGVIRRKSVME........ 671
545  4.000e-16 19  Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 gi|45656159||ref|YP_000245.1| hypothetical protein LIC10254 [Leptospira interrog protmod 77 .....AKDLMTSPVVSFLEDNPIKRAEEIFVQKRFRHVPVLNQKNTLCGILSDRDWMRWRLEHNPD---------------TTQTIGEIMTKILSVQIHARILEISKVLFEERIGCLPIINDKIEVIGIITRSDILRAILK.... 198
546  4.000e-16 17  Psychrobacter sp. 273-4 gi|41689492||ref|ZP_00146025.1| COG0516: IMP dehydrogenase/GMP reductase [Psychr protmod 85 .RVKKFEAGTVVDPITVHPEMTIGELLRLTQDNNISGVPVVEKTDKVVGIVTHRDWRFETN--------------------LSLPVSHIMTPKVTVKEGESNENIKRLLHEHRIEKVIVINDDFRLRGLITVNDFAKA....... 205
547  4.000e-16 21  Kluyveromyces lactis NRRL Y-1140 gi|50303677||ref|XP_451781.1| unnamed protein product [Kluyveromyces lactis] gi| protmod 113 .KVKKYENGFINQPIVISPETTVAEAKKMKQQFGFAGFPVTENGGKLLGIVTSRDIQFVEDNSLL--------------------VSEIMTDVVTGKKGITLEEANDILKSTKKGKLPIVDANSTLVSMLSRTDLMK........ 232
548  4.000e-16 20  Methanocaldococcus jannaschii DSM 2661 gi|15669410||ref|NP_248220.1| hypothetical protein MJ1225 [Methanocaldococcus ja protmod 86 .....VREIMEENVITLKENADIDEAIETFLTKNVGGAPIVNDENQLISLITERDVIRALLDKIDENEVIDDY---------------ITRDVIVATPGERLKDVARTMVRNGFRRLPVVSE-GRLVGIITSTDFIKLL...... 203
549  5.000e-16 18  Vibrio cholerae O1 biovar eltor str. N16961 gi|9655214||gb|AAF93932.1| inosine-5`-monophosphate dehydrogenase [Vibrio choler protmod 88 ..VKIFEAGVVTHPVTVRPEQTIADVMELTHYHGFAGFPVVTENNELVGIITGRDVRFVTD--------------------LTKSVAAVMTPKATVKEGATGAEVQEKMHKARVEKILVVNDEFQLKGMITAKDFHKAESK.... 209
550  5.000e-16 20  Methanothermobacter thermautotrophicus str. Delta H gi|15679234||ref|NP_276351.1| inosine-5`-monophosphate dehydrogenase related pro protmod 1 MVTVDIGSIMTDEVIVMDETQQVAYARNLMLRHGISRVVVVDADGKPVGIVTETDITRKL------RVNGPDWRRRPIDKISIRRV---MTNPVTVNVNDTPRDAAELMLRKNVGSLLVMDGE-ELAGIVTKKDLLR........ 128
551  5.000e-16 14  Drosophila pseudoobscura gi|54639401||gb|EAL28803.1| GA14448-PA [Drosophila pseudoobscura] protmod 997 ............NIETADETTSIITALKKFVERRVSALPLVDAEGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDEALYTIMERIVRAEVHRLVVVDEHRKVIGIISLSDIL.........1113
552  5.000e-16 19  Pseudomonas fluorescens PfO-1 gi|48730808||ref|ZP_00264554.1| COG2905: Predicted signal-transduction protein c protmod 176 ..NTRLGELAMRHPVTCSSSTPLREAVKLMHEQQVGSIVAVDEHKAPLGIFTLRDLRHVVAEGVGDF---------------SEPIERHMTSPFYLSPDHSAFDAAIAMTERHIAHVCLV-KDRRLCGVVSERDL.......... 293
553  5.000e-16 19  Methanosarcina barkeri str. fusaro gi|48839815||ref|ZP_00296744.1| COG0038: Chloride channel protein EriC [Methanos protmod 469 MSSMLVKDAMITYVQTVSEDKSVEALTTLMQVSRHVGFPVLDSKGKLSGIVTLSDLRSKVKSGDV-----------------DKKVKDIATQRLVAYPDETLDAVLKRFASKQIGRLPVVDREDRLLGLITRSDIVNA....... 592
554  5.000e-16 17  Nostoc sp. gi|25535353||pir||AI2195 two-component hybrid sensor and regulator alr3120 [impo protmod 167 LRLRLVSEVMTCEVICATPDSSMLAIAQQMTENRVSSVMIVQPQEIPVGIVTERDIVQFQALGL---------------NLETCQVQTVMSSPIFVRPDDSLRFVQQIMEQRLIRRLAVTGDQGELLGIVTQSSLLQAL...... 298
555  5.000e-16 14  Canis familiaris gi|57106779||ref|XP_543685.1| PREDICTED: similar to 5-AMP-activated protein kina protmod 310 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQAL...... 429
556  5.000e-16 18  Homo sapiens gi|15990412||gb|AAH15567.1| IMP (inosine monophosphate) dehydrogenase 2 [Homo sa protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDCFLE------------------EIMTDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKK........ 229
557  5.000e-16 23  Methanocaldococcus jannaschii DSM 2661 gi|15668834||ref|NP_247637.1| inosine-5`-monophosphate dehydrogenase (guaB) [Met protmod 9 .....VSEVMSFPVIKATKNMSIYDIANIMTENNIGAVVIV-ENNKPIGIVTERDIVKRVVSKNL--------------KPKDVLAEEVMSKKITIPQNASITEAAKIMATHGIKRLPVV-KDGELVGIVTQSDIVR........ 125
558  5.000e-16 16  Sulfolobus tokodaii str. 7 gi|15921694||ref|NP_377363.1| hypothetical protein ST1405 [Sulfolobus tokodaii s protmod 174 .....IKSLISKKLVALKPDMTLKEASQIFYKEGIRGAPVLDNEGKTLGILTTADIIKAFFEGKY-----------------DAKVSEYMSNVISIRDEDDILTAIKKMLIYNVGRLLVYNQDQKVIGIVTRTDILKTIA..... 292
559  5.000e-16 20  Microbulbifer degradans 2-40 gi|48863794||ref|ZP_00317687.1| COG0794: Predicted sugar phosphate isomerase inv protmod 199 ....RVSDVMHDQVPKIHRAASLGETLSMMTAKGFGMTAVMDDSDKLVGIFTDGDLRRCVDKGI---------------NIGSAIVGDVMTNPRTVQSRMLAAQALNLMETNKITALIVEDENQKAVGVLHMHDLLRA....... 320
560  5.000e-16 22  Methanococcoides burtonii DSM 6242 gi|53731222||ref|ZP_00148225.2| COG0517: FOG: CBS domain [Methanococcoides burto protmod 189 .........MSKKVEKASSDMKIGEAAKVMVKNNFRRLPVV-KKGILIGVVNASAIMNFFGSGEV----FENLVTGNFHEAMDVPISSLVSDVVWTTSDTDLGEASSLMLKHGVGSLPIID-NGKLCGIITERDVLRAIAE.... 315
561  5.000e-16 22  Methanococcus maripaludis S2 gi|45358016||ref|NP_987573.1| Neutral zinc metallopeptidases, zinc-binding regio protmod 210 .....AKDIMSKNIVYVNSEDTVDDVLNLMLENRFLGYPVL-ENGNIIGTITMNEISSTTAK--------------------TAKVKEIMSPPVMVSPEAALNELIKGMA--NTDRVYVVD-NGNILGIISKTDIVRTLS..... 320
562  5.000e-16 22  Anabaena variabilis ATCC 29413 gi|53765213||ref|ZP_00161442.2| COG2202: FOG: PAS/PAC domain [Anabaena variabili protmod 11 ....TIEQVMECYPLTVLPDTLLVDVIALMSASNFSSCVLVVEEKKLVGIFTLRDVVRLTGVG---------------VDISRKKISEVMTQPVTLAAAQNALTALAFMRQHHIRHLPVVDEQGQLLGLITQDRI.......... 138
563  6.000e-16 18  Cricetulus griseus gi|90204||pir||B31997 IMP dehydrogenase (EC 1.1.1.205) - Chinese hamster gi|1582 protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGITLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKK........ 229
564  6.000e-16 17  Streptomyces avermitilis MA-4680 gi|29606701||dbj|BAC70762.1| hypothetical protein [Streptomyces avermitilis MA-4 protmod 3 .....VRDAMSTVVLTIGPAHTLRQAARLMSARRVGAAVVLDEDSCGVGILTERDILNSLALGQNPDAETAG--------------SHTTTDVVFAAPAWTLEDAATAMSHGGFRHLIVLDGSG-PVGIVSVRDIIRCWAPARQ. 126
565  6.000e-16 18  Chloroflexus aurantiacus gi|53797627||ref|ZP_00358393.1| COG0538: Isocitrate dehydrogenases [Chloroflexus protmod 483 .....VGAVMTRAVVAVPAEASLRETSIYMRGRGIHSVIVKPDASGEWGIMTMRDVLK--------------KVVREGRAIDGLTVGDLTSRPLSVSPDTPITECAALMVERNIRRLAVF-ENGEPVGIISETDIFSHVAE.... 604
566  6.000e-16 16  Oryza sativa (japonica cultivar-group) gi|34912162||ref|NP_917428.1| P0712E02.24 [Oryza sativa (japonica cultivar-group protmod 290 ............EVITVNSGDLILEAFKCMKDNKIGGVPVVEPNKKLVGSVSIRDIRFLLLRPDL-FSNFRQLTVMEFMKTIGSTVSDLVKPPLTCSPDASLGSVIDSIASRITHRIYVVDGDFEVVGVVTLRDVI......... 417
567  6.000e-16 27  Sulfolobus tokodaii str. 7 gi|15922439||ref|NP_378108.1| hypothetical protein ST2113 [Sulfolobus tokodaii s protmod 129 ....KVSEYMSKNPITVNKDSTLDEVTKIILEKNIGRL-IVEDNGKILGTITTTDLLYLAPVLKF--------------KDLKIKVKEVMTPTIVVDENEDLNYAAKLMANRKVKGIPIVSANGELKGIVTTTDIVRAL...... 249
568  6.000e-16 22  Burkholderia cepacia R1808 gi|46319187||ref|ZP_00219602.1| COG0794: Predicted sugar phosphate isomerase inv protmod 204 .....VRDVMRSDVPRVGLDATLSDALFQITEKRLGMTAVVDPDGRVAGIFTDGDLRRVLARD---------------GDFRTLPIVDVMTRPRTIGPDQLAVEAVELMERHRINQMLVVDTNGMLIGALNMHDL.......... 321
569  6.000e-16 22  Methanococcus maripaludis S2 gi|45358815||ref|NP_988372.1| CBS domain [Methanococcus maripaludis S2] gi|45047 protmod 148 .....VKDCMTENVVFATPGERLKDVARTMLRNGFRRLPVVSEE-KLVGIITSTDFVKLFGSDWAFNHMKTG----NIREITNVRIQDIMTNIVSVTSNIKLVDAIKKMNELNIGVLPVVDGE-KLIGLITEKDIVKCIYK.... 278
570  6.000e-16 22  Desulfitobacterium hafniense DCB-2 gi|53684209||ref|ZP_00103276.2| COG0517: FOG: CBS domain [Desulfitobacterium haf protmod 54 .....ITDIMHDEVPRIHADASVSEALVEMSRKRLGMTAVVDGDDRLIGLYTDGDLRR--------------TLDDRGVDLRSTRIEEVMTSPKTIGADALAVEAAQLMETHKISGLLVVDTERRVVGALNIHDLLRA....... 175
571  6.000e-16 18  Nostoc punctiforme PCC 73102 gi|23127583||ref|ZP_00109450.1| COG0517: FOG: CBS domain [Nostoc punctiforme PCC protmod 15 ....KAEDIMTKDVVTIRGSATVAEAVVLMKEKKLRALVVIRHENDAYGIVTETDIVY--------------KVTAYGKDPKQVWVYEIMSKPIVVNPDLGVEYVARLFANTGIHRAPVI--QGKLLGIISITDIL......... 132
572  6.000e-16 16  Photobacterium profundum SS9 gi|54307975||ref|YP_128995.1| putative inosine-5-monophosphate dehydrogenase [Ph protmod 86 ..VKKFEAGVVSEPVTVKPTATIADVKQLTLENGFAGYPVVSDNNELVGIITGRDVRFVTD--------------------LSIKVEDVMTPKAAAKEGASREDVEAIMQEYRVEKVLLVNDDFQLKGMITAKDFQKA....... 204
573  6.000e-16 16  Rattus norvegicus gi|34855047||ref|XP_342651.1| similar to Impdh1 protein [Rattus norvegicus] protmod 163 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKK........ 286
574  7.000e-16 18  Xenopus laevis gi|56269884||gb|AAH87281.1| LOC495924 protein [Xenopus laevis] protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKK........ 229
575  7.000e-16 21  Methanothermobacter thermautotrophicus str. Delta H gi|15679236||ref|NP_276353.1| inosine-5`-monophosphate dehydrogenase related pro protmod 135 .....VMEIMTPEPVTCQHSDPVSAVWDKMDESGFSGLPVM-KNGKLIGIITRKDLIRY----------GHARIHRESGDVRSVAVEKIMTPPIAITPDTPSEKAAFLMLERDIGRIPVVEKEADLLGIVSREDVLKAYIK.... 272
576  7.000e-16 24  Ralstonia eutropha JMP134 gi|46132836||ref|ZP_00171557.2| COG0794: Predicted sugar phosphate isomerase inv protmod 210 .....VRDVMRSAVPEVRENTPLAQALMEITRKGMAMTAVVDSDGKAIGVFTDGDLRRLL---------------ETPRDWKTVPIGDVMHNPHVVHEDQLAVEAVQVMEANRINQLLVVDHDGRLVGALHIHDLTRA....... 330
577  7.000e-16 16  Homo sapiens gi|51095068||gb|EAL24311.1| IMP (inosine monophosphate) dehydrogenase 1 [Homo sa protmod 155 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 278
578  7.000e-16 17  Microbulbifer degradans 2-40 gi|48862775||ref|ZP_00316670.1| COG0516: IMP dehydrogenase/GMP reductase [Microb protmod 148 ..VKKFEAGVVKNPITIDSSCSIKDLIALTRQHNISGVPVLD-NGDLVGIVTGRDVRFETN--------------------LDATVASIMTPKVTVLEGTAADEVRALLHKHRIEKVLVVNDKFKLCGLITVKDINKA....... 265
579  7.000e-16 15  Drosophila melanogaster gi|24648663||ref|NP_732602.1| CG17299-PH, isoform H [Drosophila melanogaster] gi protmod 282 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 398
580  7.000e-16 18  Methanothermobacter thermautotrophicus str. Delta H gi|15679235||ref|NP_276352.1| inosine-5`-monophosphate dehydrogenase related pro protmod 30 ....DVMAIARKEVISIPQTATIKEAAEIMVKNKFRRLPITNPTGKLQGIVTAMDILDFLGGGDKSKI-IDKKYDDNFLAAVNEPVKSIMTDVISITTRDSIADAVSMMLENSVGALPVVDDDEKIAGIVSERDFVLLMA..... 166
581  7.000e-16 14  Azoarcus sp. EbN1 gi|56479475||ref|YP_161064.1| hypothetical protein ebA7121 [Azoarcus sp. EbN1] g protmod 4 MTVRQILETKGAGAHAVSPGVSVFDALAVMAKHDIGAVLVT-ENDHLTGIFTERDYARKLVLKGLSSKEA--------------TVGELMTPNVTITPSHTVDEVMNIMTENRFRHLPVV-ERGKIAGIVTIGDVVKSIIVQQEE 133
582  7.000e-16 16  Shewanella oneidensis MR-1 gi|24372394||ref|NP_716436.1| CBS domain protein [Shewanella oneidensis MR-1] gi protmod 33 ....KVSDIMSTEVICISDGASLKDAHHLMQTRGVRHLPVISEDGALVGVLT----HKKMIASVLSMLNKYGQGALD-RKERYTPIATVMKDCQSLTPNEPLSTVVEYFIDNKLGCLPVVDNNKKVLGIVTSSDFIK........ 162
583  7.000e-16 25  Methanococcoides burtonii DSM 6242 gi|53731221||ref|ZP_00148224.2| COG0517: FOG: CBS domain [Methanococcoides burto protmod 3 .....VSDIMSSPVYVMEPEEPVSHARKLMLRHKISTIVVV-EGNKMVGIVTKSDLGRRLAQAEPMWRRRP---------IDKVPVKMIMTDPVTIYKDASVSQATALMVDNDINNIPVVN-NGELVGIVTRVDVVRCMSE.... 128
584  7.000e-16 16  Homo sapiens gi|57999523||emb|CAI45968.1| hypothetical protein [Homo sapiens] protmod 181 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 304
585  7.000e-16 18  Mus musculus gi|110569||pir||JT0565 IMP dehydrogenase (EC 1.1.1.205) - mouse gi|309413|gb|AAA protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKK........ 229
586  8.000e-16 23  Sulfolobus tokodaii str. 7 gi|15921060||ref|NP_376729.1| hypothetical protein ST0826 [Sulfolobus tokodaii s protmod 2 ...KAVKNYMSSPVFQVEANTSIQEVCKLMMERGVGSVIVT-ENGEPKGIFTDRDAVRAFSMGLNPTDEV--------------RLASTMGNLITVDEDTDVFVAIDIMTKNKIRHLPVKDKEGKIIGMFAITDISKAL...... 122
587  8.000e-16 25  Vibrio parahaemolyticus RIMD 2210633 gi|28900706||ref|NP_800361.1| putative formate transporter 1 [Vibrio parahaemoly protmod 307 MKNASVKDIMNPKPVTLSVEMPVAAALDTLLDNNLTSAPVVDLHNRLVGFFSAHDVMVELWCQDYIPVKDQKVVDLMSRDVVAIDASDRLVDVVTRLTSLSLEERAKSMKVSKPQVLPVL-ENGQMVGVVTRQEVLKAL...... 464
588  8.000e-16 22  Azotobacter vinelandii gi|53611258||ref|ZP_00090080.2| COG0794: Predicted sugar phosphate isomerase inv protmod 200 ....KVENIMHDSLPCVQRGTTLREALLEMTHKGLGMTVVLETDGRLAGIFTDGDLRRALDRNI---------------DVRQATIDEVMTPHKTARAGMLAAQALKIMEDHKINALVVVDEEDRPVGALNMHDLLQA....... 321
589  8.000e-16 22  Magnaporthe grisea 70-15 gi|38103936||gb|EAA50571.1| hypothetical protein MG04330.4 [Magnaporthe grisea 7 protmod 148 ................IKPGTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGL--------------KATNVTIAEIMTNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGIL---DITKCFYDAMEK 260
590  8.000e-16 18  Mus musculus gi|31981382||ref|NP_035960.2| inosine 5`-phosphate dehydrogenase 2 [Mus musculus protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKK........ 229
591  8.000e-16 18  Mus musculus gi|425158||gb|AAA20181.1| IMP dehydrogenase protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKK........ 229
592  8.000e-16 23  Methanococcus maripaludis S2 gi|45357841||ref|NP_987398.1| hypothetical protein MMP0278 [Methanococcus maripa protmod 4 .....VKDVM-KRPITLNKDDNIEKAISTFRENKISGAPVVEGE-KLVGILSESDIIKALTSHDDRFAIKIEEFKGDMENALKTEVFEAMTKVVSVSSETPITNAAEIMVKNKIKRLPVVEGE-KLAGIVTRGDLIEAM...... 152
593  8.000e-16 17  Methanosarcina barkeri str. fusaro gi|48839761||ref|ZP_00296691.1| COG0517: FOG: CBS domain [Methanosarcina barkeri protmod 3 .....VADIMSSPVYVVNTEEPVSRARKLMLRHKISTLLVLNED-KIVGIVTKSDITNRLAQAEPLWRRRP---------IDQIPIKLLMTSVISIYPEASISQAAALMLENGVHTIPVVKND--IVGIITRTDLVRYVAENKE. 130
594  9.000e-16 18  Homo sapiens gi|4504689||ref|NP_000875.1| IMP (inosine monophosphate) dehydrogenase 2 [Homo s protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDCFLE------------------EIMTDLVVAPRSITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKK........ 229
595  9.000e-16 17  Bacillus clausii KSM-K16 gi|56962511||ref|YP_174237.1| magnesium transporter [Bacillus clausii KSM-K16] g protmod 137 ...KTAGAIMTKEFVRLSVESTAKEVIEELREETIYYLYVVDKDQRLAGVVSLRDLIIAVPE---------------------MTVDEIMTQVVSVNENEDQEDVARLIQEYDFLAVPVVTPDKRLVGIITVDDVMDVL...... 257
596  9.000e-16 15  Dechloromonas aromatica RCB gi|41723898||ref|ZP_00150788.1| COG0642: Signal transduction histidine kinase [D protmod 4 MPSSTLGDIMTSDVRSLPPQATLEDAAKLMAAEHISSLLVIA-DGEALGIVTESNILRAL----------------HARQPRETRLDVIMSQPITAPSDLNLISARRLVEERNIRHLVVKNPNGTVAGIVSDTD........... 121
597  9.000e-16 21  Azotobacter vinelandii gi|53610814||ref|ZP_00089193.2| COG2905: Predicted signal-transduction protein c protmod 178 ....RLGELTARRPVFCTGGTSLREAVRLMNEHQVGSLVMVDAAEFPVGIFTLRDLRQVIAEGSGD---------------LEQPLDELMRDPARLPPSATAFDAALTMTRRHIAHICVV-ENDRLVGVISERDL.......... 293
598  9.000e-16 23  Bradyrhizobium japonicum USDA 110 gi|27382443||ref|NP_773972.1| putative inosine-5`-monophosphate dehydrogenase pr protmod 12 MKVK---DVMHKGVDWVSPDTPIAEIAKLMRAHDIGCIPI-GEDDKLVGMVTDRDIVC-------------KGLASHTFDARRATARDVMTEGICCREDDDLAKAMHHMEKLQVRRLPVINKSKRMVGIISLGDLSR........ 132
599  9.000e-16 21  Methanococcoides burtonii DSM 6242 gi|46142223||ref|ZP_00148025.2| COG0517: FOG: CBS domain [Methanococcoides burto protmod 1 .........MTKDLVTISENDSIDQVLDTFDKYHFHTYPVVNEDNVLVGTIDQNIILKILLVHRAPQIEHT---HLNAVVFQGDTAKTIMIPPVSISPNETLCDTADMILKHKIDRFCIV-EDGILVGMICKPDIIKEVYK.... 129
600  9.000e-16 16  Methanococcus maripaludis S2 gi|45358579||ref|NP_988136.1| hypothetical protein. [Methanococcus maripaludis S protmod 122 LKDVKIDKIMTKSPVTIDIDESIGKARSLMMKYNIGRLIVLDMDGKPIGMVTEDDIVKKVFKPKTKMTV--GELTGNKVPRMAQPVSMIINKPITANIGDSVAEVAEILEQQDIRGIPIF-KNDTLRGIVTRLDILKYL...... 258
601  9.000e-16 18  Sulfolobus tokodaii str. 7 gi|15921048||ref|NP_376717.1| hypothetical protein ST0813 [Sulfolobus tokodaii s protmod 140 .....VKKFMTKRVTSVYEDVSVFDATKLMIKRGFRRLPVINESGEVIGIITAADSLKLLTKTI---------LKNEPEMFFNKKVKEVATNEIYIDPEKSINEAAATMLMKKIGSLLILDSKNRPLGIITERDLIIAL...... 265
602  9.000e-16 24  Debaryomyces hansenii CBS767 gi|49657642||emb|CAG90442.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 64 ....TVLSLKPSEPIICKTSSTVYEVSQLMSAKRENCILVVNDIGELLGIFTAKDLAF--------------RIVGAGLSATLVTIDQIMTNPMCANSNTPASEALNLMVHKGFRHLPVLDENNQIVGVL---DITKCYAQQMEK 188
603  1.000e-15 Neurospora crassa gi|38566837||emb|CAE76143.1| probable nuclear protein SNF4 [Neurospora crassa] g protmod 268 ...........TDLATANMNSSVLDVIHLMVKYNISAVPIVDKDNRVMNLFEAVDVIPCIKGG------AYDELTATVGDALSQRAEDF-GGIYTCSEEDRLDSIFETIRKSRVHRLIVVDDDSRLKGIISLSDILKYV...... 388
604  1.000e-15 20  Polaromonas sp. JS666 gi|54028860||ref|ZP_00361005.1| COG0517: FOG: CBS domain [Polaromonas sp. JS666] protmod 2 ...KDVAQILKHKVYTVSPLAPVLDAVKLMAEKNLGALLVLDGE-EFVGIISERD--------------CTRKMLLADRLPRETPVRDIMSSPVYVGPRHTNEECMALMTDKRLRHLPVID-NGKLIGLVSIGDLVKDIISEQ.. 130
605  1.000e-15 16  Homo sapiens gi|47077068||dbj|BAD18464.1| unnamed protein product [Homo sapiens] protmod 122 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 245
606  1.000e-15 23  Rhodobacter sphaeroides 2.4.1 gi|22959338||ref|ZP_00006992.1| COG3448: CBS-domain-containing membrane protein protmod 246 ....RCADLMARDLVTVTPDTPVAEVAQIFRQHRFTSVPVTEGA-RMVGLIFQIHLIGAPP---------------------GAEAADVMEREVRVAPDTSAGALLPILGEGRMDAIPVV-EDDRLVGIVTRTDLVAALA..... 359
607  1.000e-15 15  Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough gi|46580259||ref|YP_011067.1| CBS domain protein [Desulfovibrio vulgaris subsp. protmod 4 .....IADLMTTNLFTLKRSDSLRDARSLMQLARIRHIPIVDGRGGFVGLLTHRDILSATISRFADVDEH-----IQGEIDAGIPVGEIMTDVVTVPPSMMLRDAAEILLHNKYGCLPVLEGE-RLVGIVTEADFLK........ 130
608  1.000e-15 21  Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis gi|25166561||dbj|BAC24751.1| guaB [Wigglesworthia glossinidia endosymbiont of Gl protmod 85 .KVKRYENGMIMNPKCVTPNTSISTIKNITIINGFGSYPVVTENGKLIGIVTRRDALCA--------------------KDINQSVCTVMTPKVTVYQGEKQEIVLSKMYDKRVEKALVVDRFFNLIGMITVKDFKK........ 203
609  1.000e-15 16  Brucella melitensis 16M gi|17987023||ref|NP_539657.1| INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE [Brucella m protmod 15 MTVRSILETKGRDVVVIASADTLSQAVAMLNKHKIGALVVCDEAGHIEGILSECDVVRALA--------------AQESQAMSKSVAEVMTSKVVCHEHHTINQVMKIMTRSRFRHMPV-EEGGKLVGIISIGDVVKRRIEDVER 145
610  1.000e-15 16  Photobacterium profundum SS9 gi|54307935||ref|YP_128955.1| Putative acetoin utilization protein AcuB [Photoba protmod 3 ....TVSDMMTPNPHTLQPHNTLADAKAIMEDVGIRHIPVTDMDEQLIGIVTQRDVLSA------QESSLEHITKNNFLSTLDIPLEKCMRTLMSVDPHASLKEAAVYMQKHKIGCLPVV-EKKRLVGIITDADFV......... 128
611  1.000e-15 12  Equus caballus gi|37811665||gb|AAR03832.1| AMP-activated protein kinase gamma subunit 3 [Equus protmod 332 ...........RDLAVVLETAPLLTALDIFVDRRVSALPVVNEEGQVVGLYSRFDVIHLAAQQTYNHLDVSVGEALRQRTVCLEGV-------LSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSD........... 447
612  1.000e-15 12  Vibrio vulnificus CMCP6 gi|27365570||ref|NP_761098.1| hypothetical protein VV12246 [Vibrio vulnificus CM protmod 147 LTTSKVRTLLTRTAPTIDASATIQTAAQRMADEQVSSLLVLDEENRIAGIVTDRDLCTRVVAQ---------------GKSPNEPVASVMTPVIRLDHNAYVYEAMLTMLRHNVHHLPILQGN-RLLGIIEATDIVRYESQN... 278
613  1.000e-15 15  Drosophila melanogaster gi|4007492||gb|AAC95306.1| SNF4/AMP-activated protein kinase gamma subunit; SNF4 protmod 344 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 460
614  1.000e-15 16  Danio rerio gi|56207809||emb|CAI21140.1| novel protein similar to vertebrate IMP (inosine mo protmod 131 .KVKRFEQGFITDPVVLSPHHTVGDVLEAKVRHGFSGIPITETGKKLVGIVTSRDIDFLSEKDNNKYLEEAMTKRE---------------DLVVAPAGVTLKEANDILQRSKKGKLPIVNDKDELVAIIARTDLKK........ 254
615  1.000e-15 23  Xanthomonas campestris pv. campestris str. ATCC 33913 gi|21232228||ref|NP_638145.1| polysialic acid capsule expression protein [Xantho protmod 210 .....ITDVMHDELPRVREDASLSEALMEMSRKRLGMTAVVDAQERLIGLFTDGDLRRALDSDI---------------DVRSAGIAEVMTNPKTIGADQLAAEAARLMEDYKINGLIVVDAQQRAVGALNIHDLLRA....... 330
616  1.000e-15 27  Aquifex aeolicus VF5 gi|15605911||ref|NP_213288.1| poly A polymerase [Aquifex aeolicus VF5] gi|298308 protmod 300 ....KVRDIMNTPPFVLEEHVSVKDALTELSERGIANAPVINREGKLVGIISKKALLKLVKLYPDEPIELF-----------------VNRDFYTLSPDAPVWEAEEILTKFGQKLIPVV-EDGTVVGVVTRLDILQAVKEDLEK 422
617  1.000e-15 18  Tetraodon nigroviridis gi|47218369||emb|CAG01890.1| unnamed protein product [Tetraodon nigroviridis] protmod 109 .KVKRFEQGFITDPVVMSPRHTVGDVVEAKTRHGFSGIPITETGKKLVGIVTSRDIDFLSEKDHD------------------KPLEEAMTDLVVAPAGVTLKEANDILQRSKKGKLPIVNNNDELVAIIARTDLKK........ 232
618  1.000e-15 21  Anabaena variabilis ATCC 29413 gi|53765213||ref|ZP_00161442.2| COG2202: FOG: PAS/PAC domain [Anabaena variabili protmod 148 LKLRCVTEVMVTEIIHALPTTSVLELSQMMSDRRISCVVIVAPQETPVGMITEKDILKV---------------QLQGLDIAQTPAQTVMSSPVFISPRESLWTVNLLMQARGVRRLVVVGEQGQMQGLVTQTNLLQVL...... 275
619  1.000e-15 24  Symbiobacterium thermophilum IAM 14863 gi|51893030||ref|YP_075721.1| acetoin dehydrogenase [Symbiobacterium thermophilu protmod 3 .....VRNVMTEDVTTVSPDDTLQQAYEIIQTKNYDCLPVTA-NRRVVGIIQLTDIYEA-------------CMRDGRQAALPRPVKEFMPDPVTVRPDDLVETAAKLMFKRDIPLLPVVHGE-RLVGVIHEHDIFRAFA..... 123
620  1.000e-15 21  Methanococcoides burtonii DSM 6242 gi|53731222||ref|ZP_00148225.2| COG0517: FOG: CBS domain [Methanococcoides burto protmod 42 ....DIMSVATKHVITIPPTTKIIDAIKIMTEKKFRHIPITNGTNKIEGIITSFDIIDFLGGDKSQLIE--NKYKGNLLAAINANISSIMQPVVSIHSTGNIKEAFELMLKHNIGSLPVVDSTDHVCGICTEKDFL......... 173
621  1.000e-15 15  Drosophila melanogaster gi|25012391||gb|AAN71304.1| RE11278p [Drosophila melanogaster] protmod 235 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 351
622  1.000e-15 16  Pan troglodytes gi|55616104||ref|XP_526030.1| PREDICTED: similar to AMP-activated protein kinase protmod 440 ...........RDLAVVLETAPILTALDIFVDRRVSALPVVNEPGQVVGLYSRFDVIVSVAGKHLAAQQTYNHLDMSVGEALRQR-TLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQAL...... 584
623  1.000e-15 23  Pyrococcus horikoshii OT3 gi|14591537||ref|NP_143619.1| hypothetical protein PH1780 [Pyrococcus horikoshii protmod 5 ....RVKTIMTQNPVTITLPATRNYALELFKKYKVRSFPVVNKEGKLVGIISVKRILVNPDEEQLAML--------------------VKRDVPVVKENDTLKKAAKLMLEYDYRRVVVVDSKGKPVGILTVGDIIRRYFAKSEK 125
624  1.000e-15 20  Rhizobium tropici gi|14194865||sp|Q9KH33|IMDH_RHITR Inosine-5`-monophosphate dehydrogenase (IMP de protmod 91 ..VKKFESGMVVNPVTIGPDATLAEALSLDEGRHFRASPVVEKSHRLVGILTNRDVRFASDPE--------------------QKIYELMTNLVTVKDGVQQHEAKRLLHTHRIEKXLVVDADSRFVGLITVKDIEK........ 208
625  1.000e-15 16  Homo sapiens gi|51095067||gb|EAL24310.1| IMP (inosine monophosphate) dehydrogenase 1 [Homo sa protmod 191 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 314
626  1.000e-15 21  Chromobacterium violaceum ATCC 12472 gi|34104633||gb|AAQ60991.1| probable KpsF/GutQ family protein [Chromobacterium v protmod 188 .....VKDLMHDALPRVAPGTPLKDALLEMSQKRLGMVTVGDADGTLHGIYTDGDLRRTLEKG---------------VDVYRLKVDEVMRKPRTIQPDKLAAEAGFLMKQHQITSLVVVDAQGKLAGVLHMHDLLHA....... 308
627  1.000e-15 23  Xanthomonas axonopodis pv. citri str. 306 gi|21109275||gb|AAM37812.1| polysialic acid capsule expression protein [Xanthomo protmod 210 .....ITDVMHADLPRVREDASLSEALMEMSRKRLGMTAVVDADGHLIGLFTDGDLRRALDSDI---------------DVRSAGIAQVMTNPRTIGADQLAAEAARLMEDYKINGLIVVDAQHRAVGALNIHDLLRA....... 330
628  2.000e-15 14  Bos taurus gi|27819632||ref|NP_777011.1| AMP-activated protein kinase subunit gamma 1 (non- protmod 203 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQAL...... 322
629  2.000e-15 14  Pan troglodytes gi|55637941||ref|XP_509039.1| PREDICTED: AMP-activated protein kinase, noncataly protmod 203 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQAL...... 322
630  2.000e-15 23  Gibberella zeae PH-1 gi|42552083||gb|EAA74926.1| hypothetical protein FG06309.1 [Gibberella zeae PH-1 protmod 108 ................IKPNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVG--------------AGAKASAVTIAEIMTNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVL---DITKCFYDAMEK 220
631  2.000e-15 19  Chromobacterium violaceum ATCC 12472 gi|34105225||gb|AAQ61581.1| conserved hypothetical protein [Chromobacterium viol protmod 2 ...QTVRQLLTRALVYVTPDSTVFQALQVMAENDIGAVLVM-ESGDIVGIFSERD--------------YARRIVLQGRTSAGTKVRDIMTSVVYVTPQQTLDECMGLMTEKRIRHLPVM-EDQTVLGILSIGDLVRATIEEQEQ 132
632  2.000e-15 16  Danio rerio gi|56207808||emb|CAI21139.1| novel protein similar to vertebrate IMP (inosine mo protmod 106 .KVKRFEQGFITDPVVLSPHHTVGDVLEAKVRHGFSGIPITETGKKLVGIVTSRDIDFLSEKDNNKYLEEAMTKRE---------------DLVVAPAGVTLKEANDILQRSKKGKLPIVNDKDELVAIIARTDLKK........ 229
633  2.000e-15 16  Mus musculus gi|34328209||ref|NP_035959.2| inosine 5`-phosphate dehydrogenase 1 [Mus musculus protmod 106 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKK........ 229
634  2.000e-15 18  Archaeoglobus fulgidus gi|7482952||pir||C69276 coenzyme F420-quinone oxidoreductase (EC 1.6.5.-) 41K ch protmod 130 .KDVKVREVMNPEVITVRRFDSAAKALSVMRTHGIDRVVVVDENNKVIGILTGKDVVDRVISPRKRARMGDSSGEKE--KTLSIMVESIMSSPVVVSRNDSVAEVIDLMVENRISSV-VVTRDGLPDGIVIKKDILEYYLK.... 267
635  2.000e-15 16  Equus caballus gi|34978681||gb|AAQ83583.1| AMP-activated protein kinase gamma subunit 3 [Equus protmod 257 ...........KPLVSISPSDSLFEAVYTLIKNRIHRLPVLDPSGAVLHILTHKRLLKFLHIFGT-LLPQPSFLSRTIQDLGIGTFRDLA----VVLETAPLLTALDIFVDRRVSALPVVNEEGQVVGLYSRFDVIHLAAQQ... 383
636  2.000e-15 14  Homo sapiens gi|21757430||dbj|BAC05117.1| unnamed protein product [Homo sapiens] protmod 212 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQAL...... 331
637  2.000e-15 16  Mus musculus gi|1708472||sp|P50096|IMD1_MOUSE Inosine-5`-monophosphate dehydrogenase 1 (IMP d protmod 106 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKK........ 229
638  2.000e-15 16  Tetraodon nigroviridis gi|47216055||emb|CAG11386.1| unnamed protein product [Tetraodon nigroviridis] protmod 107 .KVKKFEQGFITDPVVMSPRHTVGDVFEAKIRHGFSGIPVTETGKKLVGIVTSRDIDFLSEKDHD------------------RPLEEAMTDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKK........ 230
639  2.000e-15 20  Nostoc punctiforme PCC 73102 gi|23130296||ref|ZP_00112113.1| COG0038: Chloride channel protein EriC [Nostoc p protmod 440 ....TAKDVMQERVETLDAEMSLEEAMQSFARSHHRGFPVV-EDSKLVGIVTQSDLLKIR--------------ESTNHTFRDRNLADIFLKEITVTPTHTLGNVLYLLDRYQISRLPVVNG-RKLIGIITRADIIRA....... 563
640  2.000e-15 18  Agrobacterium tumefaciens str. C58 gi|17935645||ref|NP_532435.1| hypothetical protein Atu1752 [Agrobacterium tumefa protmod 5 ..VKDLLDRKGRDVVTVGPDVSIGEAAGTLHAHKIGAVVVTDADGVVLGIFTERDLVKAVAG--------------QGAASLQQSVSVAMTKNVVCQHNSTTDQLMEIMTGGRFRHVPV-EENGRLAGIISIGDVVKA....... 126
641  2.000e-15 20  Methanococcoides burtonii DSM 6242 gi|53731220||ref|ZP_00349094.1| COG0517: FOG: CBS domain [Methanococcoides burto protmod 128 .....AAEIMNKDPITVHPGDRVSHIRHIILDKDIGRFPVI-EDGKLIGIVTEQDIAKSMRAFRDIVSGNQQDT-----RIKNLIVEDIMKRGVTVQSNTLMSDVTAMMLKEKIGGLPVVNLEGDMVGFITRRNIISAFAQ.... 258
642  2.000e-15 22  Bacillus halodurans C-125 gi|10175226||dbj|BAB06324.1| BH2605 [Bacillus halodurans C-125] gi|15615168|ref| protmod 4 .....IRDVMTTDVDYCSPDDNIFEVAVKMERDNVGAVPICEEE-QLLGMVTDRDIVIRSVAK---------------KKPNSTPVKEVMSHLVTATPDMTVQEAAKLMATKQIRRLPVV-ENNRLVGICSLGDL.......... 117
643  2.000e-15 19  Thermus thermophilus HB8 gi|55980905||ref|YP_144202.1| CBS domain protein [Thermus thermophilus HB8] gi|5 protmod 12 ......RDLMRTDLVVVGPQVPLGQAHRLLVQTGVRYLPVVDG-GRYRGMVGERYLRPFLAP----------WAPASVQAQWEAPVARFLQEFPKAHPEESPEEAAFRMEAARVGALPVVEEE-VLVGLVTAFDLLRGL...... 132
644  2.000e-15 14  Sus scrofa gi|48675947||ref|NP_001001642.1| 5`-AMP-activated protein kinase gamma-1 subunit protmod 203 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQAL...... 322
645  2.000e-15 22  Bacillus licheniformis ATCC 14580 gi|52082172||ref|YP_080963.1| CBS domain,CBS domain [Bacillus licheniformis ATCC protmod 1 MKLK---DIMTTNAECCEPSAPIAEIAGKMRDYNVGSIPVC-ENGKLTGIVSDRDI--------VIRCVAENETDAAARDIMS-------TQMVTGRPDMSAEEAGDLMAEHQIRRLPIV-EDDRLVGIVALGDL.......... 115
646  2.000e-15 22  Xylella fastidiosa 9a5c gi|15838014||ref|NP_298702.1| polysialic acid capsule expression protein [Xylell protmod 210 .....ITDVMHSDLPAVHEEATLSEALLEMTRKRLGMTAIVDNEGRLQGVFTDGDLRRALDSNI---------------DVRNARINEVMTHPKTINADQLAAEAARLMEANKINGLIVVDPQQRAVGALNIHDLLHA....... 330
647  2.000e-15 10  Gibberella zeae PH-1 gi|42554513||gb|EAA77356.1| hypothetical protein FG08998.1 [Gibberella zeae PH-1 protmod 373 ...KTVREIGLSGIATAKMNSSVLDVVHLMVKYNISCVPIIDSHGRVLNVFEAVDVIPCIKGG------AYEDLDGSVGEALCKR-SDESPGIYTCSEGDRLDSIFDTVRKSRVHRLIVVDDDNKLKGIISLSDILKYV...... 504
648  2.000e-15 22  Xylella fastidiosa Ann-1 gi|52856619||ref|ZP_00041968.2| COG0794: Predicted sugar phosphate isomerase inv protmod 210 .....ITDVMHSDLPAVHEEATLSEALLEMTRKRLGMTAIVDNEGRLQGVFTDGDLRRALDSNI---------------DVRNARINEVMTHPKTINADQLAAEAARLMEANKINGLIVVDPQQRAVGALNIHDLLHA....... 330
649  2.000e-15 14  Homo sapiens gi|30583529||gb|AAP36009.1| protein kinase, AMP-activated, gamma 1 non-catalytic protmod 203 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQAL...... 322
650  2.000e-15 17  Methanosarcina mazei Go1 gi|21226600||ref|NP_632522.1| putative chloride channel protein [Methanosarcina protmod 453 MDSMLVKDAMVTHVQTVSEEKNVGTLIALMQASRHAGFPVLDSKGKLSGIVTLSDLRSKV---------KYGEVDKKIGDIATRTVE-------VAYPDETLEAVLRRLGSKQIGRLPVVDEKTKLLGLITRSDVV......... 574
651  2.000e-15 22  Xylella fastidiosa Dixon gi|53800766||ref|ZP_00038993.2| COG0794: Predicted sugar phosphate isomerase inv protmod 188 .....ITDVMHSDLPAVHEEATLSEALLEMTRKRLGMTAIVDNEGRLQGVFTDGDLRRALDSNI---------------DVRNARINEVMTHPKTINADQLAAEAARLMEANKINGLIVVDPQQRAVGALNIHDLLHA....... 308
652  2.000e-15 18  Rattus norvegicus gi|40018566||ref|NP_954530.1| IMP (inosine monophosphate) dehydrogenase 2 [Rattu protmod 106 .KVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRRLVGIISSRDIDFLKEEEHDRFLE------------------EIMTDLVVAPAGVTLKEANEILQRSKKGKLPIVNESDELVAIIARTDLKK........ 229
653  2.000e-15 22  Xylella fastidiosa Temecula1 gi|28198550||ref|NP_778864.1| polysialic acid capsule expression protein [Xylell protmod 210 .....ITDVMHSDLPAVHEEATLSEALLEMTRKRLGMTAIVDNEGRLQGVFTDGDLRRALDSNI---------------DVRNARINEVMTHPKTINADQLAAEAARLMEANKINGLIVVDPQQRAVGALNIHDLLHA....... 330
654  2.000e-15 20  Crocosphaera watsonii WH 8501 gi|46117618||ref|ZP_00174063.2| COG0517: FOG: CBS domain [Crocosphaera watsonii protmod 3 ...KTVAQVMTQDPITVTPQTPLSEAVKIIAEKRISGLPVVDEKGKLLGVISETDLMWIMILDSVIYLQNPARHDKEIHKALGQTVGEVMSDPISIKATQSLNWTLDK..................................... 118
655  2.000e-15 15  Drosophila melanogaster gi|4007490||gb|AAC95305.1| SNF4/AMP-activated protein kinase gamma subunit; SNF4 protmod 180 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 296
656  2.000e-15 21  Burkholderia fungorum LB400 gi|48788381||ref|ZP_00284360.1| COG0517: FOG: CBS domain [Burkholderia fungorum protmod 1 ....................MTVREVARIFVDNGISGAPVLDPEGHIAGMISEGDLLRRTEIGTDERKPSSWLEARDYIKTHAVKVRDVMTDVVTVQPDTPLGEVASILETRRIKRVPV-TQAGRVVGIVSRANLVQALA..... 127
657  2.000e-15 18  Archaeoglobus fulgidus DSM 4304 gi|11497827||ref|NP_069049.1| hypothetical protein AF0211 [Archaeoglobus fulgidu protmod 133 .KDVKVREVMNPEVITVRRFDSAAKALSVMRTHGIDRVVVVDENNKVIGILTGKDVVDRVISPRKRARMGDSSGEKE--KTLSIMVESIMSSPVVVSRNDSVAEVIDLMVENRISSV-VVTRDGLPDGIVIKKDILEYYLK.... 270
658  2.000e-15 16  Homo sapiens gi|25014074||sp|P20839|IMD1_HUMAN Inosine-5`-monophosphate dehydrogenase 1 (IMP protmod 106 .KVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 229
659  2.000e-15 16  Homo sapiens gi|47132577||ref|NP_059127.2| AMP-activated protein kinase, non-catalytic gamma- protmod 282 ...........KPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPSGNVLHILTHKRLLKFLHI-FGSLLPRPSFLYRTIQDLGIGTFRDLA----VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQ... 408
660  2.000e-15 16  Homo sapiens gi|6688201||emb|CAB65117.1| AMP-activated protein kinase gamma 3 subunit [Homo s protmod 282 ...........KPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPSGNVLHILTHKRLLKFLHI-FGSLLPRPSFLYRTIQDLGIGTFRDLA----VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQ... 408
661  2.000e-15 21  Nostoc sp. gi|25531493||pir||AD2103 two-component hybrid sensor and regulator all2379 [impo protmod 11 ....TIEQVMECYPLTVLPDTLLVDVIALMSASDFSSCVLVVEEKNLVGIFTLRDIVRLTGVG---------------VNISRKKISEVMTQPVTQAAAQNALTALAFMRQHHIRHLPVVDEQGQLLGLITQDRI.......... 138
662  2.000e-15 16  Equus caballus gi|37811665||gb|AAR03832.1| AMP-activated protein kinase gamma subunit 3 [Equus protmod 257 ...........KPLVSISPSDSLFEAVYTLIKNRIHRLPVLDPSGAVLHILTHKRLLKFLHIFGT-LLPQPSFLSRTIQDLGIGTFRDLA----VVLETAPLLTALDIFVDRRVSALPVVNEEGQVVGLYSRFDVIHLAAQQ... 383
663  2.000e-15 19  Debaryomyces hansenii CBS767 gi|49656111||emb|CAG88749.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 111 .KVKKYENGFINDPFVISPNETVGDVRNMKAELGFTSFPVTENGGKLVGIVTSRDV--------------------QFHDNNDSKVSEIMTTEITGEKGIDLSEGNELLRSSKKGKLPIVDASGNLVSLISLTDLQK........ 230
664  2.000e-15 25  Moorella thermoacetica ATCC 39073 gi|49236847||ref|ZP_00330903.1| COG0517: FOG: CBS domain [Moorella thermoacetica protmod 3 ....TVKSLISEKLYTIDPLASVGRAAAIMERYGIGSLPVV-EEGKLVGIITSRDVR---------------------RFHPNRLVADAMTKVITISPTASLTEAQKLMVKNKIERL-VVTSESNIVGIITYAQIMLELGK.... 117
665  3.000e-15 16  Homo sapiens gi|8215682||gb|AAF73987.1| AMP-activated protein kinase gamma subunit [Homo sapi protmod 257 ...........KPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPSGNVLHILTHKRLLKFLHI-FGSLLPRPSFLYRTIQDLGIGTFRDLA----VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQ... 383
666  3.000e-15 16  Rattus norvegicus gi|34877142||ref|XP_237293.2| similar to AMP-activated protein kinase gamma 3 su protmod 381 ...........KPLVSISPNDSLFEAVYALIKNRIHRLPVLDPSGTVLYILTHKRLLKFLHI-FGALLPRPSFLCRTIQDLGIGTFRDLA----VVLETAPILTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQ... 507
667  3.000e-15 19  Methanocaldococcus jannaschii DSM 2661 gi|15669410||ref|NP_248220.1| hypothetical protein MJ1225 [Methanocaldococcus ja protmod 4 .RVMKIAQ--NKKIVTVYPTTTIRKALMTMNENKYRRLPVVNGNNKVVGIITSMDIVDFMGGGSKYNL-IREKHERNFLAAINEPVREIMENVITLKENADIDEAIETFLTKNVGGAPIVNDENQLISLITERDVIRAL...... 140
668  3.000e-15 21  Methanothermobacter thermautotrophicus str. Delta H gi|15679234||ref|NP_276351.1| inosine-5`-monophosphate dehydrogenase related pro protmod 139 ....KVRDLMTEDVKTVTPNHTLSHVIGVMEENNISRVVVTD-NGAVEGIITSENLSFATFEDRVYFISRTSEEKKRVRTIAMLTAGDIMTDVIKVEPSVDASSAAAMMLENGISGLPVV-EDDELVGIITKTDII......... 277
669  3.000e-15 24  Corynebacterium glutamicum ATCC 13032 gi|21324056||dbj|BAB98681.1| Predicted signal-transduction protein containing cA protmod 156 ....KLGEFKIANPISCSPDTTIMDAAIKMDEFGVSSLLV-QIDGELKGIITDRDMRSRVVAKDLD---------------IQLPVSEVMTDPRCATSQGLAFEAMLLMSELRIHHLPIVD-DGQISGIVTAADIMRLL...... 274
670  3.000e-15 15  Magnetospirillum magnetotacticum MS-1 gi|23011539||ref|ZP_00051869.1| COG0517: FOG: CBS domain [Magnetospirillum magne protmod 1 MTVARILAEKGNSVVTVPPHRTVDEAIHLLAEKQIGALVVADAGGHVIGILSERDVMRALA--------------RDGAAALDQSISHYMTKVVTCTRRASIEDVMETMTEGRFRHLPVV-EDGHLVGVVSIGDVVK........ 123
671  3.000e-15 17  Anopheles gambiae str. PEST gi|55244858||gb|EAA05291.2| ENSANGP00000012632 [Anopheles gambiae str. PEST] gi| protmod 127 .KVKKYKHGFIRDPLVMGPENTVADVLEAKRKNGFTGYPITENGKRLVGIVTSRDIDFREHDVDI-------------------KLKDIMTDLITAPNGVTLQEANNIMEKSKKGKLPIVNKTGELVALIARTDLKK........ 249
672  3.000e-15 17  Burkholderia cepacia R1808 gi|46322094||ref|ZP_00222466.1| COG0517: FOG: CBS domain [Burkholderia cepacia R protmod 3 ....RVNEIMSRDVVCVAPNDTIRHAAELMQRFDIGVLPVC-EGGELVAIVTDRDLAIR---------------ALSHGHSPDTPVKAVASAPVWCIEDDGVGDVQQRMADVQLHRMPVLDGQRRVVGIVSLGDI.......... 118
673  3.000e-15 13  Drosophila melanogaster gi|24648659||ref|NP_732600.1| CG17299-PE, isoform E [Drosophila melanogaster] gi protmod 525 .......QVM--PLVSIGPDASLYDAIKILIHSRIHRLPVIDPAGNVLYILTHKRILRFLFL-YINELPKPAYMQKSLRELKIGTYNNIE----TADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAE.... 652
674  3.000e-15 14  Mus musculus gi|56104569||gb|AAH86660.1| Unknown (protein for MGC:113731) [Mus musculus] protmod 202 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQAL...... 321
675  3.000e-15 20  Methanococcus maripaludis S2 gi|45358814||ref|NP_988371.1| hypothetical protein. [Methanococcus maripaludis S protmod 7 .....VTEAMSTPVATVTLDTTAYDVANILKEKGIGCLVVLNDAGKPVGIITERDLALGVVSRNL--------------KSKEVIVEEISSKLIAIAPKSTLMDAARKMDTENVKRLPVIDGD-ELLGIVTVSDITK........ 124
676  3.000e-15 19  Idiomarina loihiensis L2TR gi|56459512||ref|YP_154793.1| Predicted sugar phosphate isomerase involved in ca protmod 201 ....RLHDVMHTRVPVIPADAIISDALLEMSRKGLGMTAIVDENQRLAGIFTDGDLRRILDNRI---------------DVHKTPIAEVMTSCITANEDMLAAEALKLMQDRKINGLIITNDDGQPCGAMNMHDLLQA....... 322
677  3.000e-15 23  Desulfitobacterium hafniense DCB-2 gi|23116428||ref|ZP_00100987.1| COG0618: Exopolyphosphatase-related proteins [De protmod 158 .RINRVRDIMSYPVKTVSPEMKLSEVEQILLKYGHTGVPVAQGE-KLVGIISRRDVDKAI-----------------KHGLAHAPVKGFMTDVVVVEADSSWEDVQRTMVQHDIGRVPVL-EDGKLAGIV............... 268
678  3.000e-15 24  Oenococcus oeni PSU-1 gi|48864708||ref|ZP_00318587.1| COG0794: Predicted sugar phosphate isomerase inv protmod 198 ...QRVKHVMHEKVPYVNEDTPINEVIYQISDYGIGMTLVKDKDGKAIGIVTDGDIRKKFL---------------SVQSVKKSVASDYMTKFVSINQEKRNRTAWQLMANHGISNLVVIDNDEKVVGVVTIHDVL......... 317
679  3.000e-15 22  Pyrococcus horikoshii OT3 gi|14590055||ref|NP_142119.1| hypothetical protein PH0107 [Pyrococcus horikoshii protmod 1 MRVMDIKVYMTKKLLGVKPSTSVQEASRLMMEFDVGSLVVINDDGNVVGFFTKSDIIRRVIVPGLPY---------------DIPVERIMTNLITANVNTPLGEVLRKMAEHRIKHILI-EEEGKIVGIFTLSDLLEA....... 127
680  3.000e-15 17  Candida albicans SC5314 gi|46439783||gb|EAK99097.1| hypothetical protein CaO19.13191 [Candida albicans S protmod 211 ...........KKLSTCTMDTPVIEVIHLLTENSVSSIPIVDGQGKLINVYEAVDILALVKGG------MYTDLDLSVGDALLRRSEEFEG-VHTCTLNDRLSTIMDTIRKSRLHRLFVVDDEGKLVSVITLSDILNYI...... 331
681  3.000e-15 16  Burkholderia cepacia R18194 gi|46314884||ref|ZP_00215468.1| COG0517: FOG: CBS domain [Burkholderia cepacia R protmod 3 ....RVTEIMSRDVVCVAPTDTIRHAAELMRRFDIGVLPVCDGP-ELVAIVTDRDLAMRGLSH---------------GHSSDTPVQAVASRPVWCVEDDGVGDVQQRMADVQLHRLPVLDRNRRLVGIVSLGDI.......... 118
682  3.000e-15 19  Candida albicans gi|1930016||gb|AAB51509.1| putative inosine-5`-monophosphate dehydrogenase [Cand protmod 111 .KVKKYENGFINDPVVISPEVTVGEVKKMGEVLGFTSFPVTENGGKLVGIITSRDI--------------------QFHEDNKSPVSEVMTKDLVVKKGISLTDGNELLRSSKKGKLPIVDAEGNLVSLISRTDLQK........ 230
683  3.000e-15 16  Sinorhizobium meliloti 1021 gi|15965170||ref|NP_385523.1| hypothetical protein SMc01002 [Sinorhizobium melil protmod 1 MSVKAILNEKGSNVITVTAQVTVQQAASLLHENHIGAVVVVDPEEHIVGIMTERDIV--------------ASIARYGAACLDKPVSSVMWQNVYCREEMSVDSLMEMMSKFRARHLPV-EREGRLAGIISIGDVVK........ 123
684  3.000e-15 18  Anabaena variabilis ATCC 29413 gi|1032480||emb|CAA55877.1| unnamed protein product [Anabaena variabilis] gi|537 protmod 3 ....KASDVMTKDVATIRSSATVAEAVKLMRARDWRALIVRRHEQDAYGIISESDIVY--------------KVIAYGRDPYKIRVYEIMSKPIAVNPDLGLEYVARLFADYGLHRAPVI--QGELVGIISLTDIL......... 120
685  3.000e-15 23  uncultured archaeon GZfos35B7 gi|52550131||gb|AAU83980.1| conserved hypothetical protein [uncultured archaeon protmod 123 LKDTKVAKVMTRSPAYVEQSESIGKARSIIRKNNVGRVLVVDENEDLVGIVTGGDILKRIYKPKRKMTVGEVKGENVPR--MGQAVSFIMSSPVSADIDANLADIANLMQTHDIRSVPIVT-DGVPRGIVTIPDIMVYLRE.... 261
686  3.000e-15 26  Caulobacter crescentus CB15 gi|16126502||ref|NP_421066.1| sugar isomerase, KpsF/GutQ [Caulobacter crescentus protmod 197 ...RTVGDLMHDELPLVAADAAMPDALLVMSEKRFGAVGVVDNAGHLAGLITDGDL------------------RRHMDGLLTHTAGEVMTHPLTIGPGALAAEALKVMNERRITVLFVV-ERERPVGILHVHDLLRA....... 315
687  3.000e-15 20  Chlorobium tepidum TLS gi|21674116||ref|NP_662181.1| inosine-5`-monophosphate dehydrogenase [Chlorobium protmod 85 .KVKRFESGIIRNPIHLFEDATIQDAIDLMIRHSISGIPVVEHEGCLLGIVTNRDLR--------------------MTASSDEKITTIMTNLVTAKEGIDLLTAEDILMRNKIEKLLIIDDNGYLKGLITFKDIQK........ 206
688  3.000e-15 19  Chlorobium tepidum TLS gi|58119404||gb|AAW65379.1| mycophenolic acid-resistant inosine-5`-monophosphate protmod 111 .KVKKYENGFINDPVVISPEVTVGEVKKMGEVLGFTSFPVTENGGKLVGIITSRDI--------------------QFHEDNKSPVSEVMTKDLVVKKGISLTDGNELLRSSKKGKLPIVDAEGNLVSLISRTDLQK........ 230
689  3.000e-15 18  Thermococcus kodakaraensis KOD1 gi|57159817||dbj|BAD85747.1| hypothetical protein, conserved, containing CBS dom protmod 48 .....VSLVMDTEFLTLHPSDSLSKLVQELRGEE-SSAVVIDGEGKLLGFVTMKDLLNFFAPPKRYSIVGLDLLKRYSINRASR-VEDIMKKPITIHVDENLGRAIQIMLETGKHHLPVVDDENRVHGVLEVKDIIRLI...... 180
690  3.000e-15 14  Drosophila pseudoobscura gi|54639401||gb|EAL28803.1| GA14448-PA [Drosophila pseudoobscura] protmod 919 .......QVM--PLVSIGPDASLYDAIKILIHSRIHRLPVIDPAGNVLYILTHKRILRFLFL-YINELPKPAYMQKSLRELKIGTYSNIE----TADETTSIITALKKFVERRVSALPLVDAEGRLVDIYAKFDVINLAAE....1046
691  4.000e-15 17  Schizosaccharomyces pombe gi|1749420||dbj|BAA13769.1| similar to Human inosin-5`-monophosphate dehydrogena protmod 52 .KVKKYENGFILDPVVFSPQHTVGDVLKIKETKGFSGIPITENGGKLVGIVTSRDV--------------------QFHKDTNTPVTEVMTPLITTAEGISLERANEMLRKSKKGKLPVVDKDDNLVALLSLTDLMKNL...... 175
692  4.000e-15 16  Vibrio vulnificus YJ016 gi|37678927||ref|NP_933536.1| putative acetoin utilization protein AcuB [Vibrio protmod 3 ....KVEDMMTRHPHTLLRSHTLGDAKNMMEALDIRHIPVVDANKQLLGIVTQRDLLSAQESSLHKSSAENSYTAA-------TPLYEVMTSIMTVEPKAGLKESAIYMQKHKVGCLPVV-EKGHLVGIITDTDFV......... 127
693  4.000e-15 16  Mus musculus gi|24371223||ref|NP_714966.1| protein kinase, AMP-activated, gamma 3 non-catatly protmod 282 ...........KPLVSISPNDSLFEAVYALIKNRIHRLPVLDPSGTVLYILTHKRLLKFLHI-FGALLPRPSFLCRTIQDLGIGTFRDLA----VVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQ... 408
694  4.000e-15 13  Drosophila melanogaster gi|24648655||ref|NP_732598.1| CG17299-PF, isoform F [Drosophila melanogaster] gi protmod 1019 .......QVM--PLVSIGPDASLYDAIKILIHSRIHRLPVIDPAGNVLYILTHKRILRFLFL-YINELPKPAYMQKSLRELKIGTYNNIE----TADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAE....1146
695  4.000e-15 13  Drosophila melanogaster gi|27228270||gb|AAN85720.1| loechrig isoform VII [Drosophila melanogaster] gi|27 protmod 525 .......QVM--PLVSIGPDASLYDAIKILIHSRIHRLPVIDPAGNVLYILTHKRILRFLFL-YINELPKPAYMQKSLRELKIGTYNNIE----TADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAE.... 652
696  4.000e-15 20  Rubrobacter xylanophilus DSM 9941 gi|45548640||ref|ZP_00188670.1| COG1994: Zn-dependent proteases [Rubrobacter xyl protmod 235 MRGLTVRDVMRRRTETVTPWHTFGQVLDSVIHGYQTDFPVVDEDGRLVGMLTRNEIMSA--------AHSPDRFSE---------VRQIMTEFPTISPEADLAEGQKLLQESGLRAIPVV-EDGELVGMLTVEDLLRDIRKLQQR 370
697  4.000e-15 17  Clostridium acetobutylicum ATCC 824 gi|15893966||ref|NP_347315.1| CBS domains [Clostridium acetobutylicum ATCC 824] protmod 2 ....KISEVMTKNVVSVSGEENIKRAAELMRDHDIGAIPVCNSD-KVIGVVTDRDIVL--------------RTVAEGSDASSENVRSIMTSPVVASPDMDAREATKIMSEKQVRRLPV-ARDGKLVGMVSLGD........... 116
698  4.000e-15 16  Danio rerio gi|50345008||ref|NP_001002177.1| zgc:91911 [Danio rerio] gi|49256673|gb|AAH74090 protmod 106 .KVKKFEQGFITDPVVMSPRHTVGDVFEAKVRHGFSGIPVTETGKKLVGIVTSRDIDFLSEKDYD------------------RPLEESMTDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKK........ 229
699  4.000e-15 21  Clostridium perfringens str. 13 gi|18144216||dbj|BAB80263.1| probable glycine betaine/carnitine/choline ABC tran protmod 250 ....KAKDIMIKNPVSVKGARTILQGIEIMRSNKVDSLLVIDKENVLKGIVTFKDIK--------------------ITNEKSRALSEIMSNPLRVNEDDSLVDILTVMNENSVGFIPVVNSEEKLVGLITRSSLLSILS..... 366
700  4.000e-15 14  Rattus norvegicus gi|1335860||gb|AAC52580.1| 5`-AMP-activated protein kinase, gamma-1 subunit protmod 195 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQAL...... 314
701  4.000e-15 19  Candida albicans gi|7920698||gb|AAF70813.1| putative inosine 5-monophosphate dehydrogenase [Candi protmod 111 .KVKKYENGFINDPVVISPEVTVGEVKKMGEVLGFTSFPVTENGGKLVGIITSRDI--------------------QFHEDNKSPVSEVMTKDLVVKKGISLTDGNELLRSSKKGKLPIVDAEGNLVSLISRTDLQK........ 230
702  4.000e-15 18  Pyrobaculum aerophilum str. IM2 gi|18313874||ref|NP_560541.1| conserved protein with 7 CBS domains [Pyrobaculum protmod 233 ..VARVWRLMFRGVAVASPDTPVDEVARYMATTGLYLVPVVDKEGKAIGAVTAWDVIYAYLYGPKEGREDVEVKRRPSRHVTGLRARDVMTDIPAVNMRDTLSRIRKVFLRTGSNILAVVDDEGRVVGFVTRRDYVTYIAE.... 389
703  4.000e-15 15  Methanosarcina mazei Go1 gi|21227406||ref|NP_633328.1| hypothetical protein MM1304 [Methanosarcina mazei protmod 3 .....VADIMSSPVYVINIDEPVSHARNLMLRHRISTLLVLNE-GKMVGIVTKTDITNRLAQAEPLWRRRP---------IDQIPIKLLMTSVITIYPEASISQAVTLMLENGVHNIPVVKND--VVGIITRTDIVRYVAEHADE 131
704  4.000e-15 22  Burkholderia pseudomallei K96243 gi|53718177||ref|YP_107163.1| hypothetical protein BPSL0538 [Burkholderia pseudo protmod 204 .....VRDVMRTEVPAVPLDATLSDALFQITAKRMGMTAVIDDANRVAGIFTDGDLRRVLERD---------------GDFRRLPIVDVMTHPRTIAPDHLAVEAVELMERHRINQMLVVDERGALIGALNMHDL.......... 321
705  5.000e-15 14  Xenopus laevis gi|49257351||gb|AAH73621.1| MGC82938 protein [Xenopus laevis] protmod 204 ............NIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVDIYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGV-------LKCYQHETLETIINRLVEAEVHRLVVVDENDVAKGIVSLSDILQCL...... 323
706  5.000e-15 23  Pyrococcus furiosus DSM 3638 gi|18976693||ref|NP_578050.1| related to inosine monophosphate dehydrogenase [Py protmod 68 ....KVRDVYKPAPV-VKPTDDLSHAAKLMLETDLRSLPVGENKAEIIGVISDLALLERVVAEEFG----------------KRKVEEFMTDVITLTPDDTVAKALATMRDHGISRIPVVDEEGKLEGLVTLHDLI......... 183
707  5.000e-15 16  Homo sapiens gi|307067||gb|AAA36114.1| IMP dehydrogenase type 1 (EC 1.1.1.205) protmod 106 .KVKNFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 229
708  5.000e-15 14  Rattus norvegicus gi|6981392||ref|NP_037142.1| AMP-activated protein kinase, noncatalytic gamma-1 protmod 202 ............NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV-------LKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQAL...... 321
709  5.000e-15 15  Drosophila melanogaster gi|24648665||ref|NP_732603.1| CG17299-PD, isoform D [Drosophila melanogaster] gi protmod 118 ............NIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQK-------CNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL......... 234
710  5.000e-15 20  Desulfotalea psychrophila LSv54 gi|51243913||ref|YP_063797.1| related to poly(A) polymerase [Desulfotalea psychr protmod 313 .......EMMTRPVITISPEISIAEANTTLTRYNITAVPAI-RDGKVAGIISRQVVEKAL-----------------YHDLGHLPVKSYMSTEVSLGPDAELAEVQELIVEQRQRLVPIL-EQGELIGVVTRTDLLRKL...... 426
711  5.000e-15 13  Thiobacillus denitrificans ATCC 25259 gi|52007430||ref|ZP_00334808.1| COG2905: Predicted signal-transduction protein c protmod 168 ....RLAAIVRREPVTCSPQSSVRQALQSMKTQGVGAMVAV-ENGVPRGILTLHDVLDRVAL---------------AGADLERPVIDIMTQLTTLPPHALAHDAALTMAKEGIRHVLVTD-NGRLTGVVSEKDL.......... 282
712  5.000e-15 26  Caulobacter vibrioides gi|51039820||tpg|DAA00345.1| TPA: KpsF-like [Caulobacter vibrioides] protmod 197 ...RTVGDLMHDELPLVAADAAMPDALLVMSEKRFGAVGVVDNAGHLAGLITXGDL------------------RRHMDGLLTHTAGEVMTHPLTIGPGALAAEALKVMNERRITVLFVV-ERERPVGILHVHDLLRA....... 315
713  6.000e-15 14  Exiguobacterium sp. 255-15 gi|46112983||ref|ZP_00200657.1| COG0517: FOG: CBS domain [Exiguobacterium sp. 25 protmod 3 .....IEQIMKTHCITIQPTNSIAHAAELMRRHKIRHLPVTNARQELLGLIGLQEMQSASSVFH----------PETFLKDQQNAVSSIMRTPITAHPLDFIEDAAVLFYEHRLSCLPIVRG-RRLVGLVTETDLLRTFVQ.... 128
714  6.000e-15 16  Magnetococcus sp. MC-1 gi|48833704||ref|ZP_00290721.1| COG0516: IMP dehydrogenase/GMP reductase [Magnet protmod 86 ..VKRHISGTVINPWTLGPDEPLKAALELMARRKVSGIPIVEADGRVAGIITNRDVRFATDDSL--------------------PIRDLMTKLVTVPQGVDMGTVKHLFHLHRIEKLLMVDDQYKLTGLITVKDI.......... 201
715  6.000e-15 16  Homo sapiens gi|33357128||pdb|1JCN|B Chain B, Binary Complex Of Human Type-I Inosine Monophos protmod 106 .KVKNFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGSKLVGIVTSRDIDFL------------------AEKDHTTLLSEVMTPLVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKK........ 229
716  6.000e-15 17  Polaromonas sp. JS666 gi|54031875||ref|ZP_00364008.1| COG0517: FOG: CBS domain [Polaromonas sp. JS666] protmod 1 .........MTRGVRTLTPADTVTSAARAMDELNVGVIPVCDGE-KLVGMVTDRDIVVRGVAQEL--------------DAKTTDLSDLMTNVRTARENEDVDEVLSEMAESQIRRLPVVDDQDRLVGIISLGDI.......... 112
717  6.000e-15 13  Debaryomyces hansenii CBS767 gi|49652940||emb|CAG85276.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 214 ...........KDIATCTMDTPVIDVIHLLTQKSVSSVPIVDEQGKLINVYEAVDVLGLVKGGI------YNDLVLSVGDALLRRPEDFEG-VHTCTLNDRLSTIMDTIRKSRLHRLFVVNDEGKLVSVITLSDILNYI...... 334
718  6.000e-15 19  Oryza sativa (indica cultivar-group) gi|33771376||gb|AAQ54304.1| putative brown planthopper susceptibility protein Hd protmod 50 .RVALLSEAMSAPVLVATAEQTLEEVECHF--ETVSGLPVIDASLRCVGVIVKSDRARASHGS-------------------KTKIAEVMTSPITLPSDKTVMDAAALMLKKKIHRLPIVNQDRQVIGIVTRADVLREL...... 167
719  6.000e-15 16  Mus musculus gi|24371227||ref|NP_714967.1| protein kinase, AMP-activated, gamma 3 non-catatly protmod 257 ...........KPLVSISPNDSLFEAVYALIKNRIHRLPVLDPSGTVLYILTHKRLLKFLHI-FGALLPRPSFLCRTIQDLGIGTFRDLA----VVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQ... 383
720  6.000e-15 21  Burkholderia pseudomallei K96243 gi|53723247||ref|YP_112232.1| hypothetical protein BPSS2229 [Burkholderia pseudo protmod 2 ...QRINEIMSRDVVHVAPSDSIRHAAELMARFDIGALPVC-QNSRLIGMITDRDL---------------AVRAVSAGKAPDTKVHEIASGPIWCFDDDQVDNVQKYMADAQVRRMPVVDHDKRLVGMLSIGDI.......... 118
721  6.000e-15 16  Vibrio vulnificus CMCP6 gi|27363916||ref|NP_759444.1| Putative acetoin utilization protein AcuB [Vibrio protmod 3 ....KVEDMMTRHPHTLLRSHTLGDAKNMMEALDIRHIPVVDANKQLLGIVTQRDLLSAQESSLHKSSAENSYTTA-------TPLYEVMTSIMTVEPKAGLKESAIYMQKHKVGCLPVV-EKGHLVGIITDTDFV......... 127
722  6.000e-15 20  Sulfolobus solfataricus P2 gi|15899317||ref|NP_343922.1| hypothetical protein SSO2588 [Sulfolobus solfatari protmod 4 ....TSRSLIKRSPVVVKVGTKAIDACKIMYQNNIGSVVIVNEKDYPVGIFTERDVLRAVAC----------------GKDLNDKVENLGTKLVTVKSNSSIGEIAEKMVKNNIRHIVVVDDEGKLIGVVSIKDIVNE....... 123
723  6.000e-15 20  Vibrio cholerae O1 biovar eltor str. N16961 gi|9657947||gb|AAF96442.1| formate transporter 1, putative [Vibrio cholerae O1 b protmod 312 ....TVKDMMNSQPVTLSVDMTTPAAIDTLLDHHLSAAPVVDMQGRLVGVLSSHDVMVDLWCQDYLPSQDQKVVDLMTRDVIAIDVNDKLVDVPTTSMGISLEERAKSMKVNKPHMLPVL-HNGQLVGVLERNDVLEAL...... 464
724  6.000e-15 19  Thermoplasma volcanium GSS1 gi|14325027||dbj|BAB59953.1| inosine-5 -monophosphate dehydrogenase [Thermoplasm protmod 120 ....RAFQIMSPDPVAVSEDDSIEEAFDSLRQLNEVEIPVVDNEERLVGIVKLNDILGIMFREKEKIKYGGYGEKERVQIAC----GSVMDPPISVDRYADVKTVVDEMMKNELHIMPIVD-SGKLVGIIDFSDLINIIKTESKE 255
725  6.000e-15 16  Sinorhizobium meliloti 1021 gi|15963832||ref|NP_384185.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN [Sinorhizobium protmod 251 ....TCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLPVLDENEKLQGTVGLRELAGKEPGSKLP-----------------------ISAAATARPSDPAIGLLPRLTDGATHAVVILDDDGKVVGIISQTDLLATLAK.... 364
726  7.000e-15 22  Thermococcus kodakaraensis KOD1 gi|57158817||dbj|BAD84747.1| hypothetical protein, conserved, containing CBS dom protmod 5 ....TVGQVVKRKAVLVRPDDTIHKVARILARNKVGSAVVVDENEEIVGIITDRDIL--------------DKVVAKGKDPKKVLVKDVMTKPVTIEDDYTIQDAIDKMMDKGIRRLLV-TRVGKPIGFVTAADLLAAL...... 125
727  7.000e-15 21  Pyrococcus abyssi gi|5457858||emb|CAB49348.1| Hypothetical protein, containing CBS domains [Pyroco protmod 37 .....VKIVMDREFLKVKPETSLFELISMFTSEETSAV-VVDDDGKLIGFITMKDLLHYFVPPRKYSIAGFGMLKKYVLN-RATRVEDVMRRPIVIGVDDDLGQAIKLMVETGKHHLPVIDKDRRVHGILEVKDIIRLI...... 169
728  7.000e-15 16  Oryza sativa (japonica cultivar-group) gi|38346640||emb|CAD40738.2| OSJNBa0072D21.10 [Oryza sativa (japonica cultivar-g protmod 269 ............KLVKVNEDQPVLKAFQLMREKGVGGLPVMDTSGKAIGNISIRDVQYLLTAPNIYKDYRTKDFLTAVRQHLQEQASPLLGSVITCRRDDEVKDIILKLDSEKIHRIYVIDDKGNTEGVITLRDII......... 398
729  7.000e-15 26  Methanococcus maripaludis S2 gi|45359029||ref|NP_988586.1| hypothetical protein MMP1466 [Methanococcus maripa protmod 1 MKVK---SLMDKKFIKIYPDFTVQTVIDLMYKNKKFSTPIVDNDGKMVGWTTAIDLMIVSDKNI--------------------PIKDIMSDVIVVNKNEPAREAVTKIVEYKVISIPVLNDEGRVVGIVRNCDITKTLSK.... 121
730  7.000e-15 15  Oryza sativa (japonica cultivar-group) gi|19386799||dbj|BAB86178.1| OJ1485_B09.7 [Oryza sativa (japonica cultivar-group protmod 281 .........MIRRLVKVRHDEPALKAFRLMRKRGVGGIPVVDHAGKPTGSIMIKDVKHLLASS-DANRDYRTLTAQEFIANARQSSGEKQMNIVTCKKEESIKEIIFKLDAEKRQRIYVVDEQGNLDGLITLRDII......... 408
731  7.000e-15 15  Methanosarcina acetivorans C2A gi|20093429||ref|NP_619504.1| hypothetical protein MA4650 [Methanosarcina acetiv protmod 3 .....VADIMSSPVYAINIDEPVSRARKLMLRHRISTLLVLNE-GKMVGIVTKSDISNRLAQAEPLWRRRP---------IDQIPIKLLMTSVITIYPEASISQAAALMLENGVHDIPVVKND--IVGIVTRTDIVRYVAEHADE 131
732  7.000e-15 18  Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 gi|45658965||ref|YP_003051.1| hemolysin [Leptospira interrogans serovar Copenhag protmod 217 .....AKDVMTHRIIGIPHDTSMDSLISIIAEHHFSRYPIYEGSDKIIGIIH---------------VQTYLTWLSNSKKGRKEKVTAIMQPPIFVPEGLSIEKVMQKLRENKQHMAIVIDEYGGVAGLLTLEDIIEEI...... 338
733  7.000e-15 15  Prochlorococcus marinus subsp. pastoris str. CCMP1986 gi|33862186||ref|NP_893747.1| MgtE family, putative magnesium transport protein protmod 148 ....TAGRLMTTEFIDLKEMQTAEEALSIVRKRAIYSLYVTDKERHLTGILSLRDLVTADP---------------------TRPIGEVMTKDVVISTNTNQEDVARAIQRYDFLALPVVDKEKRLVGIVTVDDLIDVI...... 267
734  7.000e-15 19  Thermus thermophilus HB27 gi|46200275||ref|YP_005942.1| cbs domain proteins [Thermus thermophilus HB27] gi protmod 1 .........MVPDPFRVGPWTSVREAARLMAQRRVGSLVVV-EDGQVLGVVTSRDLRGAHP---------------------NRLVVDVLKPPVAISPEASLLEAKRLMEAKGLERLLVM-RDRKLLGILTQGTLAFALGQH... 111
735  7.000e-15 18  Bacillus subtilis gi|1109684||gb|AAB01532.1| ProV protmod 250 ..VERVDQIMNTKPVTITADKTLSEAIQLMRQERVDSLLVVDGEHVLQGYVDVEIIDQCRKKANLVGEVLHEDL-------------------YTVLGGTLLRDTVRKILKRGIKYVPVVDGNRRLIGIVTRASLV......... 364
736  7.000e-15 15  Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 gi|45657779||ref|YP_001865.1| IMP dehydrogenase [Leptospira interrogans serovar protmod 103 .KVKRFENGFITDPVILGPKNVIRDLDAIKERKGFTGIPVTEDNSKLIGIVTNRDI--------------------DFEKNREITLDKVMTNLITGKEGITLQDANEIIKKSKIGKLPIVDSQGKLVSLVSRSDLKK........ 222
737  7.000e-15 18  Psychrobacter sp. 273-4 gi|46141658||ref|ZP_00204014.1| COG0794: Predicted sugar phosphate isomerase inv protmod 206 ....RVEDLMHTDLPLINQQAPLQEALFIMSAGRLGMTVVTDDKSKVVGIFTDGDLRRGLEKGIDLQTPMRELM---------------VSNPRRINKSMRASDALSVMNENAISQLLIVDDEQRLEAIITVHDLLQA....... 327
738  7.000e-15 15  Burkholderia fungorum LB400 gi|48782019||ref|ZP_00278592.1| COG0517: FOG: CBS domain [Burkholderia fungorum protmod 14 ..........NTTVFTVGADDSVYDAIKLMAEKGIGALVVTDGDS-IAGIVTERD--------------YARKVVLLDRSSKATPVRDIMSKAVFVRPDQTTDDCMALMTERRMRHLPVI-ENDRLVGMVSIGDLVKNIIAEQQ. 132
739  7.000e-15 17  Burkholderia cepacia R18194 gi|46314014||ref|ZP_00214601.1| COG0517: FOG: CBS domain [Burkholderia cepacia R protmod 17 ...........RTIYTVTKTDLVYDAIKLMAEKGIGALLVVDGDD-IAGIVTERD--------------YARKVVLQDRSSKATRVEEIMTAKVYVEPSQSTDECMALMTEHRMRHLPVLDG-GKLVGLISIGDLVKSVIADQQ. 134
740  7.000e-15 19  Burkholderia fungorum LB400 gi|48788001||ref|ZP_00283980.1| COG0517: FOG: CBS domain [Burkholderia fungorum