Homologs of:

1o59_A mol:protein-het length:355 Allantoicase
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# E-value %id Organism Protein Model Start XKFFSLADEAEFKSIIISKNKAVDVIGSKLGGQVVSFSDEWFASAENLIQPTAPIRDPTRFVHSGAWYDGWETRRHNEXEYDWVIIKXGVAAAHIIGGEIDTAFFNGNHAPFVSIEALYDEGEEGNIVEDDSRWVEIVEKFECGPSQRHLFVRGNGLTKERFTHIKLKXYPDGGIARFRLYGRVVPPELKTKDHIIDLAYVCNGAVALKYSDQHFGSVDNLLLPGRGHDXSDGWETKRSRQPGHTDWAVIQLGRESSFIEKIIVDTAHFRGNFPQFITVEGCLKESESSENTGEGTWVELVGKSKTGPDKEHVYEIRKSIRVSHVKLTIIPDGGVKRIRVWGYEnd
0.000e+00 38  Pseudomonas aeruginosa UCBPP-PA14 gi|53727729||ref|ZP_00139141.2| COG4266: Allantoicase [Pseudomonas aeruginosa UC protmod 7 .................PFRHYLDLADARLGSQVVAVSDEWFAPASRMLQAGEPVWKEGVFDDSGKWMDGWETRRKRFEGHDQAVIRLGVPGV-LKGVDIDTRFFTGNHPPAASLDGCFCTEGD---PDDSTSWSEVLPAVGLQGDSHHYHPIDD---ERPWTHLRLNIYPDGGIARLRLYGVPYRDWSSLPPGTLDLAAAVNGGRALACSDQHFGRMGNLLNPGRAINMGDGWETGRRRTPGH-DWVIVALG-HPGSIEAAVVDTLHFKGNYPESCSIQAAFVEGEARIEAQSLFWRELLPAQKLEMHQEHRFELNALGPITHVRLNIFPDGGVSRLRLFG. 327
0.000e+00 56  Debaryomyces hansenii CBS767 gi|49652955||emb|CAG85291.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 3 ....KVLSQKDFQEKIV--TQYTDVIGEKLGGKVLKFSDEWFAEAENLIKPKAPIFDANKFVPAGKWYDGWETRRHNTEEADYVIIKMGVASAKLIGCEIDTAFFNGNHAPHISVEAVSLGEDEGVESLPDSKWESVIPKTECGPSQKHFFVR-DSITETNYTHARLRMYPDGGIARFRLYGSVVPILPSDSTTILDTASVLNGGVAIDRSDQHFGTADNLLLPGRGHDMGDGWETKRSREPGHVDWVVIRLGAST-KISSVLVDTLHFRGNFPQKINVKAIVVNDKEIPRFDSDKWDLLVGDSKTGPDKELEFKVSGDKVYSHVLFTMIPDGGVKRVRVFG. 337
0.000e+00 52  Neurospora crassa gi|28881101||emb|CAD70499.1| allantoicase [Neurospora crassa] gi|32415553|ref|XP protmod 26 ..................RSSTIDLISGALGGKVLGFSDEWFAEAANLLTPTAPIRQPGKMVYTGAWYDGWETRRHNPAEFDWVVIRLGVASGTVEGVEIDTAFFNGNHAPAISVEGCFSQNDDEVLSWKGERWETILGVQECGPSQRFGWKLEN-PTKKQYTHVRLNMYPDGGIARFRLFGHAVPVFPDNTDAIFDLAAAQNGGVAISCSDQHFGTKDNLILPGRGKDMGDGWETARSRTKGHVDWTIIRLGA-PGYIQNFMVDTAHFRGNYPQQVKLQAIEWKSEGEPGADSEGWTEVVEPIKCGPDQEHVESLVKDKPFTHVKLIIVPDGGVKRLRVF.. 349
0.000e+00 38  Pseudomonas syringae pv. syringae B728a gi|23469110||ref|ZP_00124445.1| COG4266: Allantoicase [Pseudomonas syringae pv. protmod 2 ............KVYAAPFEKFVNLADARLGTRILSVTDDWFADANRLFQPTPAVWKEGVFDDNGKWMDGWESRRKRFEGYDSAVIRLGVAGT-IKGVDIDTSFFTGNFPPSASLEACFLASGE---PDENTAWTEVLPSVELQGNSHHYHEINN---DQAFSHLRFNIYPDGGVARLRVYGVPHRDWSKSADEQIDLVAALNGGRSIACSDEHYGSMSNILNPGRGVNMGDGWETARRRTPGN-DWVIVALG-HKGEVEKVIVDTLHFKGNYPDSCSIQGALVKTDSQIETQSLFWRELLPSQKLTMHAEHEFQIKAIGPITHIRLNVFPDGGVSRLRVLG. 327
0.000e+00 47  Magnaporthe grisea 70-15 gi|38109131||gb|EAA55045.1| hypothetical protein MG06702.4 [Magnaporthe grisea 7 protmod 1 .....MADKISYKTENVAATRCIDMVSAALGGKVLAFSDEWFAEAANLLTPTPPIRQPGKMVYTGAWYDGWETRRHNQEPFDWVVIRLGVASGSVEGVEVDTAFFAGNHAPGISVEGCFNLNDDEVVSWKGERWETILGYQECGPSQRFGWILNERPTTKQYTHVRLNMYPDGGIARFRLFGHAHPVFPADVNAVFDLAAAQNGGVAISCNDQHFGTKDNLLLPGRGKDMGDGWETSRSRTKGHEDWAIIKLGA-TGFVDHVVVDTAFFRGNFPQKVRLEAFSAADGTADVGHDAEWAELVAASKCGPDQEHEFQLIKDKPITHVKIVMIPDGGIKRAIITSY 354
0.000e+00 35  Ralstonia solanacearum gi|17430297||emb|CAD17062.1| PUTATIVE ALLANTOICASE (ALLANTOINE AMIDINOHYDROLASE) protmod 17 .....................YPNLADPRLGAVATFATDEFFAPKDRMLNPEPAVFIPGKYDDHGKWMDGWETRRRRNGGYDHCIVKLARPGV-VKGVDIDTSHFTGNFPPAASIDAAYLPHGE---PTDATQWTEIVPSTTLQGNSHHY---LDVFGTHAYTHLRVNIYPDGGIARLRVYGQPQVDWKADRATLFDLAAMENGAYVVEVNNQHFGLASSLLMPGRGINMGDGWETRRRREPGN-DWCIIALA-HPGRIRKIEVDTAHFKGNFADRVSLQAARVTTDATLKTQAMFWQTLLPEQKLQMDHQHYYELADLGPVTHVRFNMFPDGGVSRLRLWG. 333
0.000e+00 38  Pseudomonas fluorescens PfO-1 gi|48732007||ref|ZP_00265751.1| COG4266: Allantoicase [Pseudomonas fluorescens P protmod 2 ............KAYAVPFEKFVNLADARLGTKIISVTDDWFADANRLFQPTPAVWKEGVFDDNGKWMDGWESRRKRFEGYDSAVIRLGVPG-SIKGVDIDTSFFTGNFPPSASLEACFLASGE---PDENTQWTEVLSAVELQGNSHHYHEISN---DKAFSHLRFNIYPDGGVARLRVYGIPFRDWSAVGDEQVDLAAALNGGRALACSDEHFGRMSNILNPGRGINMGDGWETARRRTPGN-DWVIVALG-HPGEIEKIIVDTLHFKGNYPDTCSIQGAFVKTDSQIETQSLFWRELLPSQKLEMHAEHTFQINALGPITHIRLNVFPDGGVSRLRVLG. 327
0.000e+00 36  Azotobacter vinelandii gi|53612899||ref|ZP_00092119.2| COG4266: Allantoicase [Azotobacter vinelandii] protmod 2 ............KKYSVPFEQYLNLADARLGTRALYVTDDWFAPVERMLQPTEPEWKEGVYDDNGKWMDGWESRRKRFEGYDHALLRLGVPGA-IKGVDIDTRHFTGNYPPSASLEACFLAEGD---PDERTEWVEVLPAVELKGNSHHYHSVTD---PRPWSHLRFNIYPDGGVARLRVYGIPYRDWSAGADETLDLAAALNGGRALACSDEHFGRMGNLLNPGRGANMGDGWETARRRTPGN-DWVIVALG-HPGEIERIVVDTLHFKGNYPDSCSIQAAWVKTDSQIETQSLFWRELLPSQKLSMHREHEFEIRPLGPISHVRLNVFPDGGVSRLRLFG. 327
0.000e+00 34  Burkholderia mallei ATCC 23344 gi|53725678||ref|YP_104006.1| allantoicase [Burkholderia mallei ATCC 23344] gi|5 protmod 17 .....................YMNLADPRLGAKALFASDEFFAPKERMLDPEPAVFIPGKYDDHGKWMDGWETRRKRTTGHDFCVVRLARPGV-VYGVDLDTSHFTGNFPPAASIDACVSDADT---PPDDAVWETLVPATTLAGNQHHYVDVSN---PRAYTHLRVNLYPDGGLARLRVYGQPQRDWSAARGELVDLAAIENGAYLVAANNEHFGPASRMLMPGRGANMGDGWETRRRREPGN-DWAIVALA-RPGVIRRVEVDTAHFKGNFPDRCSLQAARVGTDASLVTQAMFWPMLLGEQPLGMDSVHTFELAALGPVTHVRLNIHPDGGVSRLRFWG. 333
10  0.000e+00 36  Burkholderia fungorum LB400 gi|48785139||ref|ZP_00281444.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 17 .....................YMNLADPRLGAQALFASDEFFAPKERMLEPQPAVFIPGKYDDHGKWMDGWETRRKRTTGHDYCVIRLARPGV-VHGVDLDTSHFTGNFPPAASIDACYVEGD---VPPDNADWQTLVPATTLQGNQHHYVDVNDT---RAFTHLRVNLYPDGGLARLRAYGQPKRDWEVERGTLLDLAAIENGAYLVAANNQHFGPASQMLMPGRGINMGDGWETRRRREPGN-DWAIVALA-RPGVIRKIDVDTAHFKGNFPDRCSLQAASVTTDDSLVTQAMFWPVLLGEQKLQMDHVHTFNLASLGPVTHVRFNIFPDGGVSRLRLWG. 333
11  0.000e+00 34  Burkholderia cepacia R1808 gi|46321103||ref|ZP_00221483.1| COG4266: Allantoicase [Burkholderia cepacia R180 protmod 17 .....................YMNLADPRLGAQALFASDEFFAPKERMLNPEPAVFIPGKYDDHGKWMDGWETRRKRTTGHDFCVIRLARPGV-VHGVDLDTSHFTGNFPPAASIDACSVDGDT---PPDDAAWRTIVPATTLQGNAHHYVSVSDA---QPVTHLRVNLYPDGGLARLRVYGQPQRDWHDAAGELVDLAAIENGGYLVAANNQHFGAASQMLMPGRGANMGDGWETRRRREPGN-DWAIVALA-RPGVIRRVDVDTAFFKGNFPDRCSLQAARVGTDDSLVTQAMFWAELLGEQKLQMDRVHTFQLAALGPVTHVRFNIFPDGGVSRLRLWG. 332
12  0.000e+00 34  Burkholderia pseudomallei K96243 gi|53720553||ref|YP_109539.1| putative allantoicase [Burkholderia pseudomallei K protmod 17 .....................YMNLADPRLGAKALFASDEFFAPKERMLDPEPAVFIPGKYDDHGKWMDGWETRRKRTTGHDFCVVRLARPGV-VYGVDLDTSHFTGNFPPAASIDACVSDADT---PPDDAVWETLVPATTLAGNQHHYVDVSN---PRAYTHLRVNLYPDGGLARLRVYGQPQRDWSAARGELVDLAAIENGAYLVAANNEHFGPASRMLMPGRGANMGDGWETRRRREPGN-DWAIVALA-RPGVIRRVEVDTAHFKGNFPDRCSLQAARVGTDASLVTQAMFWPMLLGEQPLGMDSVHTFELAALGPVTHVRLNIHPDGGVSRLRLWG. 333
13  0.000e+00 34  Burkholderia cepacia R18194 gi|46316041||ref|ZP_00216621.1| COG4266: Allantoicase [Burkholderia cepacia R181 protmod 17 .....................YMNLADPRLGALALFASDEFFAPKERMLNPEPAVFIPGKYDDHGKWMDGWETRRKRTTGHDFCVVRLARPGV-IYGVDLDTSHFTGNFPPAASIDACVAEGD---MPPDDAQWRPIVPATTLQGNSHHYVSVDDA---QPYTHLRVNLYPDGGLARLRVYGQPQRDWRQVPGELVDLAATENGGYLVAANNQHFGPASQMLMPGRGVNMGDGWETRRRREPGN-DWAIVALA-RPGIIRRVEVDTAFFKGNFPDRCSLQAAQVGTDDSLVTQAMFWAELLGEQKLQMDHVHTFQLAALGPVTHVRFNIFPDGGVSRLRLWG. 332
14  0.000e+00 37  Burkholderia fungorum LB400 gi|48788433||ref|ZP_00284412.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 17 .....................YVNLADPRLGAQALEASDDFFAPKERMLNPEPAVFIPGKYDDNGKWMDGWETRRKRVTGYDWCVVKLARPGV-IKGLDLDTSHFTGNFPPAASVEAARVV---DGVPNQSTQWTEIVASTTLQGNSHHYHEVSDA---NAYTHLRVNIYPDGGIARLRVYGQPQVDWAASRTEQFDLAAMENGAYLVAANNQHFGAASTILMPGRGVNMGDGWETRRRREPGN-DWAIVALA-QPGVIRKIEVDTAHFKGNYPDRCSIQAAYVTTDSSLITQAMFWPVLLGEQKLKMDNQHYFEIAALGPVTHVRFNIIPDGGVSRLRLWG. 333
15  0.000e+00 38  Burkholderia pseudomallei K96243 gi|53719727||ref|YP_108713.1| putative allantoicase [Burkholderia pseudomallei K protmod 17 .....................YVNLADPRLGAQALEASDDFFAPKERMLNPEPAVFIPGKYDDHGKWMDGWETRRKRTTGYDWCVVKLARPGV-IKGVDIDTSHFTGNFPPAASIEAAHVP---DGAPNEATKWVEIVPATTLQGNSHHY---VEARDANAYTHLRVNLYPDGGIARLRVYGQPQLDWAASRSALFDLAAMENGGYVVAANNQHFGLASNVLLPGRGVNMGDGWETRRRREPGN-DWAIVALA-QPGVIRKVEIDTAHFKGNYPDRCSIQAAYVGTDSSLVTQAMFWPVLLGEQKLQMDKQHAFELAALGPVTHVRLNIIPDGGVSRLRVWG. 333
16  0.000e+00 39  Burkholderia cepacia R18194 gi|46311887||ref|ZP_00212488.1| COG4266: Allantoicase [Burkholderia cepacia R181 protmod 17 .....................YVNLADPRLGAQALEASDDFFAPKDRMLNPEPAVFIPGKYDDHGKWMDGWETRRKRTTGYDWCIVKLARPGV-IKGFDIDTSHFTGNFPPAASIEAAFVA---DGAPTHATEWVEIVPSTTLQGNSHHYVEASDA---RAFTHLRVNIYPDGGIARLRVYGQPQLDWAASATEQFDLAAMENGGYVVAANNQHFGVASNLLLPGRGVNMGDGWETRRRREPGN-DWAIIALA-QPGVIRKIEVDTAFFKGNYPDRCSIQAAYVGTDSSLITQSMFWPVLLGEQKLQMDKQHYFEIASLGPVTHVRLNIIPDGGVSRLRLWG. 333
17  0.000e+00 38  Burkholderia cepacia R1808 gi|46318939||ref|ZP_00219364.1| COG4266: Allantoicase [Burkholderia cepacia R180 protmod 17 .....................YVNLADPRLGAQALEASDDFFAPKERMLNPEPAVFIPGKYDDHGKWMDGWETRRKRTTGYDWCIVKLARPGV-IKGVDIDTSHFTGNFPPAASIDAAYVA---DGAPTQATEWIEIVPSTTLQGNSHHY---VEARDARAFTHLRVNIYPDGGVARLRVYGQPQLDWAASATEQFDLAAMENGGYVVAANNQHFGLASNLLLPGRGVNMGDGWETRRRREPGN-DWAIVALA-QPGVIRRIEVDTAFFKGNYPDRCSIQAAYMGTDSSLITQSMFWPVLLGEQKLQMDKQHFFEIAALGPVTHVRLNIIPDGGVSRLRLWG. 333
18  0.000e+00 97  Saccharomyces cerevisiae gi|666107||emb|CAA42994.1| allantoicase [Saccharomyces cerevisiae] protmod 2 .KFFSLADEAEFKSIIISKNKAVDVIGSKLGGQVVSFSDEWFASAENLIQPTAPIRDPTRFVHSGAWYDGWETRRHNEMEYDWVIIKMGVAASHIIGGEIDTAFFNGNHAPFVSIEALYDEGEEGNIVEDDSRSLEIVEKFECGPSQRHLFVRGNGLTKERFTHIKLKMYPDGGIARFRLYGRVVPPELKTKDHIIDLAYVCNGAVALKYSDQHFGSVDNLLLPGRGHDMSDGWETKRSRQPGHTDWAVIQLGRESSFIEKIIVDTAHFRGNFPQFITVEGCLKESESSENTGEGTWVELVGKSKTGPDKEHVYEIRKSIRVSHVKLTIIPDGGVKRIRVWGY 343
19  0.000e+00 98  Saccharomyces cerevisiae gi|557835||emb|CAA86189.1| dal2 [Saccharomyces cerevisiae] gi|82896|pir||JH0442 protmod 2 .KFFSLADEAEFKSIIISKNKAVDVIGSKLGGQVVSFSDEWFASAENLIQPTAPIRDPTRFVHSGAWYDGWETRRHNEMEYDWVIIKMGVAAAHIIGGEIDTAFFNGNHAPFVSIEALYDEGEEGNIVEDDSRWVEIVEKFECGPSQRHLFVRGNGLTKERFTHIKLKMYPDGGIARFRLYGRVVPPELKTKDHIIDLAYVCNGAVALKYSDQHFGSVDNLLLPGRGHDMSDGWETKRSRQPGHTDWAVIQLGRESSFIEKIIVDTAHFRGNFPQFITVEGCLKESESSENTGEGTWVELVGKSKTGPDKEHVYEIRKSIRVSHVKLTIIPDGGVKRIRVWGY 343
20  0.000e+00 98  Saccharomyces cerevisiae gi|46015794||pdb|1SG3|B Chain B, Structure Of Allantoicase gi|46015793|pdb|1SG3| protmod 2 .KFFSLADEAEFKSIIISKNKAVDVIGSKLGGQVVSFSDEWFASAENLIQPTAPIRDPTRFVHSGAWYDGWETRRHNEMEYDWVIIKMGVAAAHIIGGEIDTAFFNGNHAPFVSIEALYDEGEEGNIVEDDSRWVEIVEKFECGPSQRHLFVRGNGLTKERFTHIKLKMYPDGGIARFRLYGRVVPPELKTKDHIIDLAYVCNGAVALKYSDQHFGSVDNLLLPGRGHDMSDGWETKRSRQPGHTDWAVIQLGRESSFIEKIIVDTAHFRGNFPQFITVEGCLKESESSENTGEGTWVELVGKSKTGPDKEHVYEIRKSIRVSHVKLTIIPDGGVKRIRVWGY 343
21  0.000e+00 29  Canis familiaris gi|57098093||ref|XP_532861.1| PREDICTED: hypothetical protein XP_532861 [Canis f protmod 69 ................................................LESDSPSFREHEYTEFGKWMDGWETRRKRIPGHDWCIIKLGIQGI-IRGFDVDISYFMGDYAPRMSIQAANLEEDEAVAELKSDDWNYLVPMTELKPGSSHNYFAVN--SQERWSHIRLNIFPDGGIARLRVYGMGQKDWTADPKEPFDLVAIAHGGTCVGYSNAHFGHPNNMIGVGKARSMADGWETARRLDPPVLEVGDSRAGSAVQFGQRLL-------------CKLDGCILTTQEEEDLPGQKWKPLLPVTKLSADESHLFHLELQDVITHARLTITPDGGVSRLRLKGF 383
22  0.000e+00 37  Nocardia farcinica IFM 10152 gi|54027211||ref|YP_121453.1| putative allantoicase [Nocardia farcinica IFM 1015 protmod 14 ..................FTELPDLAVRSLGGAVIWADDEFFAEKENLIVPEAPEFRPATYGHRGQVYDGWETRRHRGPGDDAAVVRLGVPGV-IHGVVVDTSWFTGNYPPAISLSALAIDGYPPAAIAARTDWVPLLDRVPVRGDARNPFPI---PSRDRWTHVRLTMHPDGGIARLRVHGEGRPDPALLGLGPVDLAALENGALVLDCSDRFYGSPHQLLHPGNARRMGDGWETARRRDDGN-DWVRIRLA-GPGLIRLAELDTSYFLGNSPAAARLTG---------RTTDGTEVELLPRTPLQPDTRHRFPTAAAASVEEVRLDIYPDGGLARVRLFG. 325
23  0.000e+00 31  Streptomyces avermitilis MA-4680 gi|29605641||dbj|BAC69706.1| putative allantoicase [Streptomyces avermitilis MA- protmod 26 .........ADYRTADFPFTQYANLADRQLGAGVIAANDEFFAQRENLLVAGRAEFDPEHFGHKGKIMDGWETRRRRGEDHDWALVRLGAPGV-VRGVVVDTAHFRGNYPQAVSVEGASVPGSPEELLAGDVKWMTLVPRTAVGGHAANGFEV---SVEQRFTHLRVNQHPDGGIARLRVYGEAVPDPWLAALGTFDVVALENGGRVEDASNLFYSPATNTIQPGRSRQMDDGWETRRRRDHGN-DWIRYQLVARSE-IRAIEIDTAYLKGNSAGWAAV--------SVKDGESGEWTEILPRTRLQPDTNHRFTLAAPVAGTHARVDIFPDGGISRLRLFG. 357
24  0.000e+00 38  Cryptococcus neoformans var. neoformans B-3501A gi|50258337||gb|EAL21026.1| hypothetical protein CNBD4020 [Cryptococcus neoforma protmod 11 ..........EFDSNI--KSNYVEVSSSALGGEVVACSDDFFASCHNLIKPTPSVSMKGQFGPNGALYDGWESRRHNP-AYDWVIIRLATPLTSLHYVDIDTSHFNGNEAPQSQVFALSLPSDTPMWTQGNPGWVEVLPVVDLGPNSRHIFEVGKAGKEGKWGAVMVNMMPDGGMARFRAYGLPQPANYQSLQPT-NLLSPLIGGRIISCSDAQFSPPGNLLLPGRGVDMSDGWETRRSQEPGGKEWAVAKLGV-PGIVRWVEVDTAFHPGNYPKYCAVEATLS---SDEDLSSASWTTIVRKTPCGAHRQHYLPLEPNVPFSHIRYSVFPDGGTKRVRIFGH 362
25  0.000e+00 44  Aspergillus nidulans FGSC A4 gi|40744499||gb|EAA63675.1| hypothetical protein AN3104.2 [Aspergillus nidulans protmod 10 ............EDIDKVFAHTTNLASAALNSKVLACSNDYFAAASNLLTPTPPINRPGVFIHTGAWYDGWETRRHNPDPYDWVVIKLGVASGAIQGVEVDTGFFVGNYGEKAELQATYAPGISDAEVADPSYWTTILPPQECGPSQRRAWKLNDAANPTPYTHVRLLMYPDGGFGRLRLYGHAIPPTLESTSPTEELSSALLGGLALGASDQHYTPCSNLLLPGRGKDMGDGWETARSRAKGHVDWAVIKLGL-PGSVSKVVVDTKDFRGNFPRAVRVHAGSVGSDEVPAHDHAGWTEIVGDKPCQADTEHVFEAADSGIFTHAKLTLVPDGGVKRFRVFG. 356
26  0.000e+00 33  Streptomyces coelicolor A3(2) gi|6273653||emb|CAB60167.1| putative allantoicase [Streptomyces coelicolor A3(2) protmod 26 .........ADYRTADLPFTQYANLADRQLGAGVVAANDEFFAQRENLLVPEPAEFDPEHFGHKGKVMDGWETRRRREEDHDWALIRLGAPGV-IRGIVVDTAHFRGNYPQAVSVEGASVAGSPEELLADDVKWTTLVPRTPVGGHAANGFAV---SAEQRFTHLRLKQHPDGGIARLRVYGEVVADPWLAALGTFDVVALENGGQVEDASNLFYSPATNTIQPGRSRKMDDGWETRRRRDKGN-DWIQYRLVDRSQ-IRAIEIDTAYLKGNSAGWASV--------SVKDGEAGEWREVLPRTRMQPDTNHRFVLPEAAVGTHARVDIFPDGGISRLRLFG. 357
27  0.000e+00 32  Rattus norvegicus gi|34863241||ref|XP_216673.2| similar to allantoicase [Rattus norvegicus] protmod 14 .................................................KSNNPSFKENEYTEFGKWVDGWETRRKRIPGHDWCVIQLGIQGI-IRGIDVDISYFSGNYAPRMSIQAANLSEDTAITELKSHSWDYLVPMSELKPDSSHNYFFVN--SQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAADSTEPVDLVAIAFGGVCVGFSNAHFGHPNNMIGVGDPKSIADGWETARRRPPPGCEWAVFRLA-HPGVITQIEIDTKYFKGNSPDSCKVDGCILTTLEEEDLPAHKWKPLLPVTKLTPNQNHLLTLELQDVITHARITIAPDGGVSRLRLKGF 365
28  0.000e+00 32  Homo sapiens gi|14718648||gb|AAK72970.1| allantoicase [Homo sapiens] protmod 1 .....................................TDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQGV-IRGFDVDVSYFTGDYAPRVSIQAANLEEDEAIAEPKSDDWSYLVPMTELKPGSGHNYFLVN--SQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTADPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRRPPPGCEWAVFRLA-HPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVLPAHKWKPLLPVTKLSPNQSHLFTLELQDVITHARLTIV............. 337
29  0.000e+00 48  Gibberella zeae PH-1 gi|42552795||gb|EAA75638.1| hypothetical protein FG05993.1 [Gibberella zeae PH-1 protmod 3 ....SIADEIEYKNVDVSRSTCIDLISSGLGGKVLDYSDQWFCEASNLLNPRAPIAQPGKMVFTGAWYDGWETRRHNQEPFDYAIIKLGVASGTIEGLEIDTAFFNGNHAPAISVEGVFSQDDDKVVSWGGGRWETILGIQECGPSQRFAWKL-KTHGQKAYTHVRLNMYPDGGIARFRLFGHAVPVFPEDKDAIFDLAAAQNGGIAVSCSDQHFGTKDNLLIPGRGKDMGDGWETKRSRGKDHTDFAIIKLGAPG------------------------------KADPVADATAWRVFVPPSKTGPDQEHEFESEKKGPVTHVKLIMIPDGGL........ 320
30  0.000e+00 44  Ustilago maydis 521 gi|46097147||gb|EAK82380.1| hypothetical protein UM01926.1 [Ustilago maydis 521] protmod 7 .........DQFDAVLGSTSTEI--SSVALGGRILSTSDEWFAPASSLLKVGPAPSLRGQFGPKGALFDGWETRRHNPT-YDWVILRLGPAGGHLVGFDVDTANFNGNEAPEISIHALALTPEEEALAEDDKRWECVVPISPCGPSQRHLFKVAEGKGDKIYTHIKLHMIPDGGIARFRVYGVIPPPPVGQADGLLDLAHCLNGGRVVFTDDNHFGAGSNIILPGRGKDMGDGWETRRSRAKGHFNWSIVKLG-EPGFLSYAEVDTAHFLGNFPESTEILGTVHDSATVPSADA-QWVTLLPRTKLGPGRRHFFPLGNSAPFTHVMIKMHPDGGIKRFRVHG. 353
31  0.000e+00 32  Pan troglodytes gi|55594433||ref|XP_525676.1| PREDICTED: similar to allantoicase isoform a; alla protmod 71 ................LDLTQLMNMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQGV-IRGFDVDVSYFTGDYAPRVSIQAANLEEDEAIAELKSDDWSYLVPMTALKPGSGHNYFLVN--SQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTADPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRRPPPGCEWAVFRLA-HPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEEALPAHKWKPLLPVTKLSPNQSHLFTLELQDVITHARLTIVPDGGVSRLRLWGF 534
32  0.000e+00 33  Sinorhizobium meliloti 1021 gi|16264535||ref|NP_437327.1| putative allantoicase protein [Sinorhizobium melil protmod 12 ..................AGGTINLASAGLGARALFATDEFFGPLERMLKDEPAAFHPGLYDDHGKWMDGWETRRRRGAGHDYAVIALAAKG-RIAGFDVDTSHFTGNYPSACSIEACHSAEDPD----EATEWVQLLPVTGLGPNAHHFFA---AHSDAVYSHIRLRIHPDGGIARLRVYGTPALDLKAMANETIDLASCLLGGRIVAFSNGHYGHER-LIAPGRGANMGDGWETRRRREPGY-DWIIVKLAAR-GHVERILVDTAHFKGNYPDACSLQAATAECDMLVASSAMFWNELLPHRKLSADSVHEYMLRHADPVTHVRLNIYPDGGVSRLRIYG. 332
33  0.000e+00 36  Tetraodon nigroviridis gi|47213097||emb|CAF89517.1| unnamed protein product [Tetraodon nigroviridis] protmod 14 .................DFLQFNDLACETVGGKVLFATDEYFAPSSNLLKGALPRFDTSAYTEFGKWMDGWETRRKRSPGHDWCIIQLGVPG-RVWGVDVDTSFFTGNHSPRVSVQGACLDAPPDAIVEGSEAWPELVPVSPLMPGYAHNYFTV--GYTHTVTHLRLNMHPDGGGARLRVYGVGQRTWTTSAHEDVDLVALPNGGVCLGFSNAHFGHPRNMIGLGQAASMADGWETARRRPPAGWEWAVFRLG-HPGTVHTVEVDTRHFKGNSPDSCWVEACSLSPAEEVRATSGTWCLLLPPQKLRPHHRHLFQLRWSAPVTHVRLLISPDGGVSRLRLWG. 379
34  0.000e+00 40  Acinetobacter sp. ADP1 gi|50086496||ref|YP_048006.1| allantoicase [Acinetobacter sp. ADP1] gi|49532472| protmod 14 .................SLHSLTNLADSRIGAQIVECSDDFFAEAKRMLQFEAPIFVEDKFDDHGKWMDGWETRRKRHAGYDWCIVKLGVAG-KIKAVDIDTTFFTGNYPASASLEGCYAP----NGNTQEALWQPLLGNSILGPSQHHVFDVQN---DAIFTHIRLNIFPDGGVARLRIYGDVQ-IQITDTDQTLDLLALQNGGRVIAYSDAHFGHPRNLINPGRGVNMGDGWETKRRRAPG-FDWCLLALG-QAGKIEKIEIDTAHFKGNYPAQVSIQAIYIETDPQLIPQSMFWPFLLEAQDMQMDHIHSYEVLAHEKVSHIRVNMIPDGGISRVRLWG. 331
35  0.000e+00 35  Burkholderia fungorum LB400 gi|48780954||ref|ZP_00277614.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 18 ......................INLADPRLGAQAVLASDDFFAPMDRMLNPEPAVFIPGKYDDNGKWMDGWESRRKRVTGHDFCVVKLSAAG-KLMGVDIDTSHFTGNFPPAASIDACRSDDD---IPSADAQWTEVIPATELSGNAHH-FRVIQAAGGALYTHVRLNIYPDGGVARLRVFGR--PHREIAPDAELDLASAMNGARIVAANNQHYGLASNLLLPTRAANIGEGWETRRRREPG-CDWCIVELAV-PGEISRVDVDTAHFKGNFADRCSLQGAFVTTDESLITQSMFWPVLLDEQKLEMDRLHSFAPERIAPVSHVRFNILPDGGVSRLRLIG. 330
36  0.000e+00 35  Branchiostoma belcheri tsingtaunese gi|32396164||gb|AAP41914.1| allantoicase [Branchiostoma belcheri tsingtaunese] protmod 13 ..................FTQLNDLACAKAGGRVLFATDDWFAVADNLLKGDPPQWKEGVFTEYGKWMDGWESRRKRMEGHDWCIVQLGVSGV-ISGVEVDTSYFTGNYAPRFSLQAACLPDGTGMEEIKTEEWTELVPMTALRPGYPDTCQNYHITSTQRWTHVRLNMYPDGGIARLHVYGIGSKDWSTVKNELVDLVAMDNGGVCLGFSNAHYGHPRNAIGLGRADNMGDGWETARRRPPPGCEWAVYRLG-HPGVILKIEIDTNHFKGNYPDSCRIEACTLPTEEKAVLGRDKWKTLLGPTKLSAHRRLFLQVQPVGVVSHVRLTMTPDGGISRMRLWGF 383
37  0.000e+00 47  Schizosaccharomyces pombe gi|1067211||emb|CAA91956.1| SPAC1F7.09c [Schizosaccharomyces pombe] gi|1351910|s protmod 12 ............EQADAFFGQSVDLISRALGGQVLGCSDDFFASCENLINPADPIRKAGVFVETGAWYDGWETRRHNTAPCDWVIVKLGPSSGRVTGCEIDTTFFNGNHAPEVSVEAAFLPE---GNPDAKTNWTPILPKLPCGPTQRHIY-RFKEIPQQNFTHVRLCMYPDGGIARFRLYGNVVPVFPADLDARLDLAHMYLGGLVVQCSDQHFGKKDNLLLPGRGVNMGDGWETARSREKGHVDWVIVKLGAR-GYIDDALIDTNHFKGNYPKEVILEAI--DSPDHIPGPDAQWVTILPARKLGPHMEHVFTNNNSTPMTHVRMIIIPDGGVKRLRIYG. 337
38  0.000e+00 35  Danio rerio gi|55251108||emb|CAH68966.1| novel protein similar to vertebrate allantoicase (A protmod 16 ..................FLQFNNLACETAGGKVIFATDEWFAPARNLLKRDPPEFIASAFTEFGKWMDGWETRRKRIPGHDWCIVQLGVPGI-IHGFDVDTSFFTGNYAPFASIQATCLEGDRTGMAASPSQWKEVVPVTKLKAGYSHNYLSV--SYPHRVTHIRFNIYPDGGIARLKVYGIGKKDWSSVGQDLVDLVALVNGGVCVGFSDAHYGHPRNMIGLGMAENMGDGWETARRLDRPRVEWAIFRLG-HPGIISKIELDTNHFKGNFPDSCRIEACSLTEDEENSFISPMWNILLPPQKMKAHHRHVFSGPSLGPVSHVRMVIAPDGGISRLRIWG. 383
39  0.000e+00 35  Danio rerio gi|50540500||ref|NP_001002716.1| zgc:91799 [Danio rerio] gi|49904277|gb|AAH76445 protmod 16 ..................FLQFNNLACETAGGKVIFATDEWFAPARNLLKRDPPEFIASAFTEFGKWMDGWETRRKRIPGHDWCIVQLGVPGI-IHGFDVDTSFFTGNYAPFASIQATCLEGDRTGMAASPSQWKEVVPVTKLKAGYSHNYLSV--SYPHRVTHIRFNIYPDGGIARLKVYGIGKKDWSSVGQDLVDLVALVNGGVCVGFSDAHYGHPRNMIGLGMAENMGDGWETARRLDRPRVEWAIFRLG-HPGIISKIELDTNHFKGNFPDSCRIEACSLTEDEENSFISPMWNILLPPQKMKAHHRHVFSGPSLGPVSHVRMVIAPDGGISRLRIWG. 383
40  0.000e+00 35  Burkholderia fungorum LB400 gi|48785542||ref|ZP_00281792.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 18 ......................INLADPRLGAEAVLTSDDFFAPMARMLDPNPAVFIAGKYDDNGKWMDGWESRRKRVAGHDFCIVKLGVAG-ELMGVDIDTSYFTGNFPPAASIDACRCDDD---IPGAHSPWTEVLPATALNGNAHH-YRAIDAATRDIYTHVRLNIYPDGGVARLRVYGRPRRD--LSPGVELDLASATNGARIVAANNEHYGAASNLLLPTRAANMGEGWETRRRREPG-CDWCIIELAT-PGEISQISVDTAHFKGNFADRCSLQGAWVGTDESLITQSIFWPVLLDEQKLEMGRVHTFVPTQSMPVTHVRFNILPDGGVSRLRLIG. 330
41  0.000e+00 60  Kluyveromyces lactis NRRL Y-1140 gi|50303575||ref|XP_451729.1| unnamed protein product [Kluyveromyces lactis] gi| protmod 4 ...FKENQAKEFETIVSQQYQSVEILNNRVQGQVISFSDQWFADAANLLTPTAPVRDATRFTHAGAWYDGWETRRHNTEEYDWVIIKAGVYAARIIGCEVDTAYFNGNHAPAIAVQGLYSEEGEETLSENDSRWTDVIEKVECGPSQRHFFLR-DSLTESHYNYFKLKMFPDGGIARFRLYGKVVPPALFDSAIGLDLCNIVNGAVAISVSDQHFGSANNLIMPGRGHDMSDGWETSRSRTPGHVDWAIIQLGRGTKHINRVVVDTAHFRGNFPQFITVHGIKTLGESAPSHDDSNWICLVDKSKTGPDKEHEYVINKSLEITHIKLTIIPDGGVKRVRVF.. 351
42  0.000e+00 56  Ashbya gossypii ATCC 10895 gi|44983808||gb|AAS52844.1| AER162Cp [Ashbya gossypii ATCC 10895] gi|45190766|re protmod 15 ...FSDKQRAEFERQVAKTWGAVDVVCRRLGSEVISCSDEWFGEAARLVHESAPVREAGRFTEAGAWYDGWETRRHNPAPYDWVIIKLGVYSARIVGCEVDTAYFDGNHAPSISVDA--LRAETGPVEEDDPRWAEVVPRVECGPSRRHFFLRKH-RTDAAYTHVKLKMYPDGGIARFRLYGQVLPVPAQDGSFTINLAGVHQGAVALQASDQHFGNVENLLLPGRGHDMSDGWETRRSREPGHCDWAIIRLARRSHYLSRIVVDTIHFRGNFPQYVTVHGICKDSP--PEHDDPGWQLIVDRSATGPDQEHEYAVDKFIFLTHVKLTIIPDGGVKRLCVWGY 357
43  0.000e+00 33  Mus musculus gi|16716445||ref|NP_444386.1| allantoicase [Mus musculus] gi|9255889|gb|AAF86348 protmod 14 ................LDFTQLIDLASECVGGKVLFATDDFFGPAENLIKSDSPTFKEHEYTEFGKWVDGWETRRKRIPGHDWCVIQLGIQGI-IRGIDVDISYFSGNHAPRMSIQAANLSEEDTMTELKSHSWDYLVPMSELKPDSSHNYYFVN--SQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAAGSTEPVDLVAIAFGGVCVGFSNAHFGHPNNMIGVGEPKSIADGWETARRRPPPGCEWAVFRLA-HPGVITQIEIDTKYFKGNCPNSCKVDGCILTTLEEENLPAHKWKSLLPVTKLIPNQNHLLTLELQDVITHAMITIAPDGGVSRLRLKGF 386
44  0.000e+00 37  Xenopus tropicalis gi|51950119||gb|AAH82508.1| Unknown (protein for MGC:89169) [Xenopus tropicalis] protmod 7 ............ENIGLPVSEFVNLACESVGGKVLFATDDCFAPAENLLKKKDPEFKPGLFTEFGKWMDGWETRRKRIPGHDWCIIELGVPGI-IHGFEADTRFFTGNYAPRISVQAACLKPEEITFQPKSEKWSHLLQMTELTPGYSHSYFNVN--SKQRWTHLRLNIYPDGGIARFKVYGIGQRDWSCKPNDLEDLLSMVNGGVCLGFSDAHYGHPRNLIGIGRACDMGDGWETARRRPPPGFEWAVLKLG-HPGLVTHIEIDTNHFKGNSPNSCKIDACALTPTEEEGVKRDEWKPLLSVTQIHPHKRRYVELALHQVISHVKITIAPDGGVSRIRLWGF 384
45  0.000e+00 38  synthetic construct gi|49087802||gb|AAT51498.1| PA1515 [synthetic construct] protmod 7 .................PFRHYLDLADARLGSQVVAVSDEWFAPASRMLQAGEPVWKEGVFDDSGKWMDGWETRRKRFEGHDQAVIRLGVPGV-LKGVDIDTRFFTGNHPPAASLDGCFCAEGD---PDDSTSWSEVLAAVGLQGDSHHYHPIDD---ERPWTHLRLNIYPDGGIARLRLYGVPYRDWSNQPPGTLDLAAAVNGGRALACSDQHFGRMGNLLNPGRAINMGDGWETGRRRTPGH-DWVIVALG-HPGSIEAAVVDTLHFKGNYPESCSIQAAFVEGEARIEAQSLFWRELLPAQKLEMHQEHRFELNALGLITHVRLNIFPDGGVSRLRLFG. 327
46  0.000e+00 52  Neurospora crassa gi|101840||pir||A35829 allantoicase (EC 3.5.3.4) - Neurospora crassa gi|168749|g protmod 26 ..................RSSTIDLISGALGGKVSGFSDEWFAEAANLLTPTAPIRQPGKMVYTGAWYDGWETRRHNPAEFDWVVIRLGVASGTVEGVEIDTAFFNGNHAPAISVEGCFSQNDDEVLSWKGEGWETILGVQECGPSQRFCWKLEN-PTKKQYTHVRLNMYPDGGIARFRLFGHAVPVFPDNTDAIFDLAAAQNGGVAISCSDQHFGTKDNLILPGRGKDMGDGWETARSRTKGHVDWTIIRLGA-PGYIQNFMVDTAHFRGNYPQQVKLQRIEWKSEGRPGADSEGWTEVVEPIKCGPDQEHVESLVKDKPFTHVKLIIVPDGGVKRLRVF.. 349
47  0.000e+00 37  Photobacterium profundum SS9 gi|54309429||ref|YP_130449.1| putative allantoicase [Photobacterium profundum SS protmod 4 ...............ALNFEQYVNLADPKLGAEAIFATDDFFADKSRLIRTEAAEWKEDLYDDNGKWMDGWESRRKRSEGYDFCVVRLGLAGT-IAGLDIDTSFFTGNFPPSASVDACYSPDGE---PSDSTEWQEILSSQSLQGDSHHLHALDN---EQVFTHVRLNIYPDGGVARLRVYGRPSVNWDQGIDQEVDLAAVVNGGRALACSDEHFGKKSNILGPGRGENMGDGWETARRRTPGN-DWVIVALG-RPGKIGKVVVDTAHFKGNFPDSCSIQAAYVGTDDQVETQSLFWRELMPSQKLSAHNIQEFQVNDLGAVTHVRLNIFPDGGISRLRLFGF 327
48  0.000e+00 32  Homo sapiens gi|40548427||ref|NP_060906.2| allantoicase isoform a [Homo sapiens] gi|20987689| protmod 14 ................LDFTQLMDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQGV-IRGFDVDVSYFTGDYAPRVSIQAANLEEDEAIAELKSDDWSYLVPMTELKPGSGHNYFLVN--SQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTADPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRRPPPGCEWAVFRLA-HPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVLPAHKWKPLLPVTKLSPNQSHLFTLELQDVITHARLTIVPDGGVSRLRLRGF 384
49  0.000e+00 38  Xenopus laevis gi|38014420||gb|AAH60404.1| MGC68581 protein [Xenopus laevis] protmod 16 ..................FLQMNNLACESVGGKVLFATDDWFAPAEHLLKKTEPEFKVGLFTEFGKWMDGWETRRKRIPGHDWCIIQLGVPGI-IHGFEADTRFFTGNYAPRISVQAACLKPEEITLQPKSEKWSHLLKMTELKPGYSHSYFQVN--SKERWTHLRLNIYPDGGIARFKVYGIGQRDWSCGPNDFEDLLSMVNGGVCLGFSDAHYGHPRNLIGNGRACDMGDGWETARRRPPPGFEWAVLKLG-HPGLVTHIEIDTNHFKGNSPNSCKIDACALKPTEQEEVKGHGWKPLLPVTQIHPHKRHFMELALHQVISHVKITIAPDGGVSRIRLWGF 384
50  0.000e+00 38  Xenopus laevis gi|4929823||gb|AAD34169.1| allantoicase [Xenopus laevis] gi|9910617|sp|Q9W6S5|AL protmod 16 ..................FLQMNNLACESVGGKVLFATDDWFAPAEHLLKKTEPEFKVGLFTEFGKWMDGWETRRKRIPGHDWCIIQLGVPGI-IHGFEADTRFFTGNYAPRISIQAACLKPEEITLQPKSEKWSHLLKMTELKPGYSHSYFQVN--SKERWTHLRLNIYPDGGIARFKVYGIGQRDWSCGPNDFEDLLSMVNGGVCLGFSDAHYGHPRNLIGNGRACDMGDGWETARRRPPPGFEWAVLKLG-HPGLVTHIEIDTNHFKGNSPNSCKIDACALKPTEQEEVKGHGWKPLLPVTQIHPHKRHFMELALHQVISHVKITIAPDGGVSRIRLWGF 384
51  0.000e+00 38  Pseudomonas aeruginosa PAO1 gi|9947472||gb|AAG04904.1| allantoicase [Pseudomonas aeruginosa PAO1] gi|1134742 protmod 7 .................PFRHYLDLADARLGSQVVAVSDEWFAPASRMLQAGEPVWKEGVFDDSGKWMDGWETRRKRFEGHDQAVIRLGVPGV-LKGVDIDTRFFTGNHPPAASLDGCFCAEGD---PDDSTSWSEVLAAVGLQGDSHHYHPIDD---ERPWTHLRLNIYPDGGIARLRLYGVPYRDWSNQPPGTLDLAAAVNGGRALACSDQHFGRMGNLLNPGRAINMGDGWETGRRRTPGH-DWVIVALG-HPGSIEAAVVDTLHFKGNYPESCSIQAAFVEGEARIEAQSLFWRELLPAQKLEMHQEHRFELNALGPITHVRLNIFPDGGVSRLRLFG. 327
52  0.000e+00 57  Candida albicans SC5314 gi|46441462||gb|EAL00759.1| hypothetical protein CaO19.9612 [Candida albicans SC protmod 3 ....KILSQDDFQKQIVS--QYTDVIGEKLGGKVLSFSDQWFADAENLIKPKPPIRDATRFTYAGAWYDGWETRRHNEAEADWVIFKLGVSSAKLIACEVDTAFFNGNHAPHISVEALFDASDENLQNVKEEDWEEVIAKVECGPSQKHFFSRG-SLTNKNYTHARLRMYPDGGIARFRLYGQVIPVTDQSSSSVTDFASVQNGGVAIKFSDQHFGTADNLLLPGRGHDMSDGWETKRSREPGHTDWVIIRLGA-PAKLSEIVVDTAHFRGNFPQKVNVKGINVDEESKIEANSDAWEVVVDDSKTSADKEHAFKVDNSKVYSHIKLTIIPDGGVKRIRAFG. 339
53  0.000e+00 53  Yarrowia lipolytica CLIB99 gi|49648849||emb|CAG81173.1| unnamed protein product [Yarrowia lipolytica CLIB99 protmod 6 .......SESDFNRQIVS--NYTDVAGEKLGGKVLSFSDEWFAEAANLIKPYAPIREAGKFVDSGAWYDGWETRRHNTEPADWVVCRFGVAAAHIVGTEIDTAYFNGNHAPEISVECTSLNEADEAAALKSASWDTVISKHECGPSQKQ-FFVLDKPTSKTYTHARLNMYPDGGIARFRLYGSVVPDFSQSKDVEIDLASVLNGGQAVARSDQHFGSADNLLLPGKGENMGSGWETKRSREPGHVDWVVIRLGA-PGTINKIVLDTAWFKGNFPQKMTVSAVNLKPGESIAADDDRWVEVLAPVQGAPHVEKEYPVDNKHVFSHVKLTIIPDGGVSRIRVFG. 340
54  0.000e+00 32  Rattus norvegicus gi|50926129||gb|AAH78971.1| Unknown (protein for MGC:93851) [Rattus norvegicus] protmod 14 ................LDFTQLIDLASECVGGKVLFATDDFFGPAENLIKSNNPSFKENEYTEFGKWVDGWETRRKRIPGHDWCVIQLGIQGI-IRGIDVDISYFSGNYAPRMSIQAANLSEDTAITELKSHSWDYLVPMSELKPDSSHNYFFVN--SQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAADSTEPVDLVAIAFGGVCVGFSNAHFGHPNNMIGVGDPKSIADGWETARRRPPPGCEWAVFRLA-HPGVITQIEIDTKYFKGNSPDSCKVDGCILTTLEEEDLPAHKWKPLLPVTKLTPNQNHLLTLELQDVITHARITIAPDGGVSRLRLKGF 385
55  0.000e+00 37  Pseudomonas syringae pv. tomato str. DC3000 gi|28854072||gb|AAO57137.1| allantoicase [Pseudomonas syringae pv. tomato str. D protmod 2 ............KVYAAPFEKFVNLADARLGTKILSVTDDWFADANRLFQPTPAVWKEGVFDDNGKWMDGWESRRKRFEGYDSAVIKLGVAGT-LKGVDIDTSFFTGNFPPSASLEACFLASGE---PDENTAWTEVLSSVELKGNSHHYHEISH---DQAFSHLRFNIYPDGGVARLRVYGVPHRDWSKVTSEQIDLVAALNGGRSIACSDEHYGSMSNILNPGRGVNMGDGWETARRRTPGN-DWVIVALG-HKGEVEKVIVDTLHFKGNYPDSCSIQGAFVKTDSQIETQSLFWRELLPSQKLTMHAEHEFQVKAIGPITHIRLNVFPDGGVSRLRVLG. 327
56  3.000e-81 23  Plasmodium yoelii yoelii gi|23478061||gb|EAA15248.1| allantoicase, putative [Plasmodium yoelii yoelii] protmod 79 ............NINDVNFLNFNNVLSKNFGAKVAFVTDESISKSENLIIEDKT---------------GWITRRRRDVGHEWLIFKLKYPSI-IYGIELNFENMDEDICPHLSIEVVENPCIDDIIKEQNTPWVELLQAKQCNKKKIYYFKINDQSLIKPWTHIRINLYPDGGINKIHFYGEFVKHTIASKQKIF-LNKPENGCTLIYCDEIHKGHPKNII----DSYKTDGFCTKRNRPPSIKNFAIFKFGVR-GIIENFTIDIGNYKHDHPETIQIQKKIFEDDEKLAKKKIDWFQL-PPCKINTGQKKTFYNFNLLEYTHFKISIHPDGGISQVNIIG. 471
57  9.000e-81 22  Plasmodium berghei gi|56492376||emb|CAI04950.1| conserved hypothetical protein [Plasmodium berghei] protmod 79 ............NINDVNFLNFNNVLSKNFGAKVLFVTDESISKSENLIIEDKT---------------GWVTRRRRDVGHEWLIFKLKYPSI-IYGIELNFENMDEDICPHLSIEVVENPCIDDIIKEQNTPWVELLQAKQCNKKKIYYFKINDQSLIKPWTHIRINLYPDGGINKINFYGEFVKHTIASKQKIF-LNKPENGCTLIYCDDIYKGHPKNII----DSYKTDGFCTKRNRPPLIKNFAIFKFGVR-GVIENFTIDIGNYKHDHPETVQIQKKIFEDDEKLVKKKIDWFQL-PPCKINTGQKKTFYNFNLLEYTHFKISIHPDGGISQVNI... 469
58  2.000e-71 32  Danio rerio gi|55251109||emb|CAH68967.1| novel protein similar to vertebrate allantoicase (A protmod 1 ................................KVIFATDEWFAPARNLLKRDPPEFIASAFTEFGKWMDGWETRRKRI---------------------------PGNYAPFASIQATCLEGDRTGMAASPSQWKEVVPVTKLKAGYSHNYLSV--SYPHRVTHIRFNIYPDGGIARLKVYGIGKKDWSSVGQDLVDLVALVNGGVCVGFSDAHYGHPRNMIGLGMAENMGDGWETARRLDRPRVEWAIFRLG-HPGIISKIELDT............................................................................. 241
59  8.000e-70 41  Xenopus tropicalis gi|21667347||gb|AAM74031.1| allantoicase [Xenopus tropicalis] protmod 1 ....................................................................DGWETRRKRIPGHDWCIIELGVPGI-IHGFEADTRFFTGNYAPRISVQAACLKPEEITFQPKSEKWSHLLQMTELTPGYSHSYFNVN--SKQRWTHLRLNIYPDGGIARFKVYGIGQRDWSCKPNDLEDLLSMVNGGVCLGFSDAHYGHPRNLIGIGRACDMGDGWETARS........................................................................................................ 192
60  2.000e-69 42  Xenopus muelleri gi|21667357||gb|AAM74036.1| allantoicase [Xenopus muelleri] protmod 1 ....................................................................DGWETRRKRIPGHDWCIIELGVPGI-IHGFEADTRFFTGNYAPRISVQAACLKPEEITLQPKSQKWNHLLKMTELKPGYSHNYFQVN--SKERWTHLRLNIYPDGGIARFKIYGIGQRDWSCGPNDLEDLLSMVNGGVCLGYSDAHYGHPRNLIGIGRACDMGDGWETARS........................................................................................................ 192
61  2.000e-67 41  Litoria infrafrenata gi|21667353||gb|AAM74034.1| allantoicase [Litoria infrafrenata] protmod 1 ....................................................................DGWETRRKRIPGHDWCIIELGIPGV-IHGLYVDTHFFTGNYAPRVSVQVACLPEEDFKAVEHSEKWEYLLKMTELKPGYTESCCNYNVSSKGRWTHIRLNIYPDGGIARFKVYGIGQRDWSCGPNDMEDLLSMANGGVCLGYSDAHYGHPRNLIGLGRAADMGDGWETARS........................................................................................................ 191
62  3.000e-67 40  Bufo marinus gi|27777725||gb|AAM74032.2| allantoicase [Bufo marinus] protmod 1 ....................................................................DGWETRRKRIPGHDWCIIELGVPGV-IHGFHVNTRFFTGNYAPRISVQVACLQEGSAATEEDSEKWEYLLKMTELTPGYAHSYF--HVASKERWTHIRLNIYPDGGIARFKVYGIGQRDWSCGPNDLEDLLSMVNGGVCLGYSDAHYGHPRNLIGIGRACDMGDGWETARS........................................................................................................ 191
63  1.000e-66 40  Ciona intestinalis gi|21667351||gb|AAM74033.1| allantoicase [Ciona intestinalis] protmod 1 ....................................................................DGWETRRKRIPGHDWCIIELGIPGV-IHGLYVDTHFFTGNYAPRVSVQVACLPEEDFKAVEHSEKWEYLLKMTELKPGYTESCCNYNVSSKGRWTHIRLNIYPDGGMARFKVYGIGQRDWSCGPNDMEDLLSMANGSVCLGYSDAHYGHPRNLIGLGRAADMGDGWETARS........................................................................................................ 191
64  3.000e-64 34  Rattus norvegicus gi|21667355||gb|AAM74035.1| allantoicase [Rattus norvegicus] protmod 1 ....................................................................DGWETRRKRIPGHDWCVIQLGIQGI-IRGIDVDISYFSGNYAPRMSIQAANLSEDTAITELKSHSWDYLVPMSELKPDSSHNYFFVN--SQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAADSTEPVDLVAIAFGGVCGGFSNAHFGHPNNMIGVGDPKSIADGWETARS........................................................................................................ 193
65  3.000e-58 37  Anopheles gambiae str. PEST gi|55240877||gb|EAA09264.3| ENSANGP00000012342 [Anopheles gambiae str. PEST] gi| protmod 1 ....................................................................DGWETRRKRTPGHDWCLVELGAP-TQIAGVMIDTAFFTGNYVPRVSIQAGTLDAEELGMVQGTDQWDVLVPRTELQPTRRHYFTVAKGKQSLIVNHLRVNMFPDGGIARLRVYGTVRLNESLSVRQPFDMIAMLNGGRCTGFSNAHYGHPRNLIKPSTAVNMGDGWETARR........................................................................................................ 204
66  2.000e-57 30  Plasmodium yoelii yoelii gi|23486503||gb|EAA20813.1| hypothetical protein [Plasmodium yoelii yoelii] protmod 2119 .............................................................................................................................NTLHKKYQWVSILEDERMNPNYNHNCFNINTCNK-IFTHLIVCLLPDGGINKLRVYGEIISKNEKQKNKIINVSNILDGSNVVYTTDEFYGKSDNILI-DQNSKYVMGWQTRRNRPLRYVDYCIIKLSYITN-VKYIEINTIFYEYNFPLCISIDHCYVEEKSSDNIHNIEWKELLPLSYIKGNHINYFTINNSLPSSHLRLNIYPDGGINTIKVFG.2375
67  7.000e-57 30  Plasmodium berghei gi|56500289||emb|CAH95622.1| conserved hypothetical protein [Plasmodium berghei] protmod 1189 .............................................................................................................................NTLHKKYQWVSILEDERMNPNYNHNCFNINTCNK-IFTHLIVCLLPDGGINKLRVYGEIISKNEKQKNKIINVSNILDGSNVVYTTDEFYGKSDNILI-DQNSKYVMGWQTRRNRPLRYVDYCIIKLSYITN-VKYIEINTIFYEYNFPLCISIDHCYVEEKSSDNIHNIEWKELLPLSYIKGNHINYFTISNSLPSSHLRLNIYPDGGINTIKVFG.1445
68  4.000e-54 25  Plasmodium falciparum 3D7 gi|23612655||ref|NP_704216.1| hypothetical protein [Plasmodium falciparum 3D7] g protmod 2251 ................................................................................YDSIYFRNGIRKNEINEKNVNTTHLNYDYNNYYNTSTLFLDNDYSNELHKKYQWVSILEDERMNPNYNHNCFNINTCNK-IFTHLIVCLLPDGGINKLRVYGEIKNNEKARKKKTINVCNILDGANIVYTTDEFYGKSENILI-DHNSEYVMGWQTRRSRPLRYVEYCIIKLSYITN-IKYIEINTIFYEYNSPLCVSIDSCNLKEHPQEKTQNIQWVQLLPLSYIKGNHINFFSINKNLISTHLRLNIYPDGGINTIKVYG.2564
69  3.000e-51 29  Plasmodium chabaudi gi|56526065||emb|CAH77945.1| conserved hypothetical protein [Plasmodium chabaudi protmod 588 .............................................................................................................................NTLHKKYQWISILEDERMNPNYNHNCFNINTCNK-IFTHLIVCLLPDGGINKLRVYGEIISKNVKQKNKIINVSNILDGSSVVYTTDEFYGKSDNILI-DQNSKYVMGWQTRRNRPLRYVDYCIIKLSYIAN-VKYIEINTIFYEYNFPLCVSIDHCYAEEKSSDNIHNIEWKELLPLSYIKGNHINYFTINPAALSSHLRLNIYPDGGINTIKVFG. 844
70  3.000e-50 22  Plasmodium falciparum 3D7 gi|23509606||ref|NP_702273.1| hypothetical protein PF14_0384 [Plasmodium falcipa protmod 253 .....................................................................................IKNMHGTQTIVNYEKNTKRKSYNFLDSYKID----KSISDLLEQQNTPWVELLQAKTVGKKKTYYFKINNELIKKPWTHIRVNLYPDGGINKINFYGEFIKHTIISKQKIF-LNKPENGCTLIYYHCDHKGHPKYII----DSCKTDGFCTRRNRPPNNCNSSIFKFGVR-GIVENFTIDIGNYKYDHPECIQIQKKIFEEDEKLLKKKMEWIQL-PPFKITTNQKKTFFHFNLLEYTHFKISIHPDGGISQINVIG. 546
71  1.000e-40 32  Burkholderia cepacia R18194 gi|46316041||ref|ZP_00216621.1| COG4266: Allantoicase [Burkholderia cepacia R181 protmod 179 ................VPAGELVDLAATENGGYLVAANNQHFGPASQMLMP-------GRGVNMG---DGWETRRRREPGNDWAIVALARPGI-IRRVEVDTAFFKGNFPDRCSLQAAQVAGGDDSLVTQAMFWAELLGEQKLQMDHVHTFDQLAALG--PVTHVRFNIFPDGGVSRLRLWGEP............................................................................................................................................................... 334
72  2.000e-40 30  Burkholderia cepacia R1808 gi|46321103||ref|ZP_00221483.1| COG4266: Allantoicase [Burkholderia cepacia R180 protmod 178 ...............DVAAGELVDLAAIENGGYLVAANNQHFGAASQMLMPGR-----------GANMDGWETRRRREPGNDWAIVALARPGV-IRRVDVDTAFFKGNFPDRCSLQAARVAGGDDSLVTQAMFWAELLGEQKLQMDRVHTFDQLAALG--PVTHVRFNIFPDGGVSRLRLWGEP............................................................................................................................................................... 334
73  3.000e-40 27  Plasmodium chabaudi gi|56506987||emb|CAH85802.1| conserved hypothetical protein [Plasmodium chabaudi protmod 4 .....................................................................GWVTRRRRDVGHEWLIFKLKYPSI-IYGIELNFENMDEDICPHLSIEVVENPCIDDIIKDQNTPWVELLQAKQCNKKKIYFFKINDQSLIKPWTHIRINLYPDGGINKINFYGEFVKHTIASKQKIF-LNKPENGCTLLYCDDIYKGHPKNII......................................................................................................................... 205
74  2.000e-39 35  Pseudomonas aeruginosa PAO1 gi|9947472||gb|AAG04904.1| allantoicase [Pseudomonas aeruginosa PAO1] gi|1134742 protmod 174 .................PPGTALDLAAAVNGGRALACSDQHFGRMGNLLNPGRAINMG----------DGWETGRRRTPGHDWVIVALGHPG-SIEAAVVDTLHFKGNYPESCSIQAAFVEGGEARIEAQSLFWRELLPAQKLEMHQEHRFERLNALG--PITHVRLNIFPDGGVSRLRLFGRPQLP............................................................................................................................................................ 332
75  2.000e-39 34  Pseudomonas aeruginosa UCBPP-PA14 gi|53727729||ref|ZP_00139141.2| COG4266: Allantoicase [Pseudomonas aeruginosa UC protmod 173 ................LPPGTALDLAAAVNGGRALACSDQHFGRMGNLLNPGRAINMG----------DGWETGRRRTPGHDWVIVALGHPG-SIEAAVVDTLHFKGNYPESCSIQAAFVEGGEARIEAQSLFWRELLPAQKLEMHQEHRFERLNALG--PITHVRLNIFPDGGVSRLRLFGSPQLP............................................................................................................................................................ 332
76  2.000e-39 36  Homo sapiens gi|55824666||gb|AAH35356.1| Allantoicase, isoform b [Homo sapiens] gi|40548425|r protmod 2 ......................................................................................................................................................................................................................................ADGWETARRRPPPGCEWAVFRLA-HPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEEALPAHKWKPLLPVTKLSPNQSHLFTLELQDVITHARLTIVPDGGVSRLRLRGF 137
77  2.000e-39 35  Homo sapiens gi|7677260||gb|AAF67097.1| putative allantoicase [Homo sapiens] protmod 2 ......................................................................................................................................................................................................................................ADGWETARRRPPPGCEWAVFRLA-HPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVLPAHKWKPLLPVTKLSPNQSHLFTLELQDVITHARLTIVPDGGVSRLRLRGF 136
78  3.000e-39 31  Burkholderia pseudomallei K96243 gi|53720553||ref|YP_109539.1| putative allantoicase [Burkholderia pseudomallei K protmod 181 ..................RGELVDLAAIENGAYLVAANNEHFGPASRMLMPGR-----------GANMDGWETRRRREPGNDWAIVALARPGV-IRRVEVDTAHFKGNFPDRCSLQAARVAGGTDALVTQAMFWPMLLGEQPLGMDSVHTFETQLAAL-GPVTHVRLNIHPDGGVSRLRLWGE................................................................................................................................................................ 334
79  5.000e-39 30  Burkholderia mallei ATCC 23344 gi|53725678||ref|YP_104006.1| allantoicase [Burkholderia mallei ATCC 23344] gi|5 protmod 181 ..................RGELVDLAAIENGAYLVAANNEHFGPASRMLMPGR-----------GANMDGWETRRRREPGNDWAIVALARPGV-IRRVEVDTAHFKGNFPDRCSLQAARVAGGTDALVTQAMFWPMLLGEQPLGMDSVHTFETQLAAL-GPVTHVRLNIHPDGGVSRLRFWGE................................................................................................................................................................ 334
80  7.000e-39 34  Burkholderia cepacia R18194 gi|46311887||ref|ZP_00212488.1| COG4266: Allantoicase [Burkholderia cepacia R181 protmod 177 ..............AGASATEQFDLAAMENGGYVVAANNQHFGVASNLL-------LPGRGVNMG---DGWETRRRREPGNDWAIIALAQPGV-IRKIEVDTAFFKGNYPDRCSIQAAYVSGGTDSLITQSMFWPVLLGEQKLQMDKQHYFEQ-DIASLGPVTHVRLNIIPDGGVSRLRLWGT................................................................................................................................................................ 334
81  7.000e-39 35  synthetic construct gi|49087802||gb|AAT51498.1| PA1515 [synthetic construct] protmod 174 .................PPGTALDLAAAVNGGRALACSDQHFGRMGNLLNPGRAINMG----------DGWETGRRRTPGHDWVIVALGHPG-SIEAAVVDTLHFKGNYPESCSIQAAFVEGGEARIEAQSLFWRELLPAQKLEMHQEHRFERLNALG--LITHVRLNIFPDGGVSRLRLFGRPQLP............................................................................................................................................................ 332
82  4.000e-38 35  Acinetobacter sp. ADP1 gi|50086496||ref|YP_048006.1| allantoicase [Acinetobacter sp. ADP1] gi|49532472| protmod 171 ..........DVQIQITDTDQTLDLLALQNGGRVIAYSDAHFGHPRNLINP-------GRGVNMG---DGWETKRRRAPGFDWCLLALGQAG-KIEKIEIDTAHFKGNYPAQVSIQAIYIEDTDPQLIPQSMFWPFLLEAQDMQMDHIHSY-LNEVLAHEKVSHIRVNMIPDGGISRVRLWGKVV.............................................................................................................................................................. 334
83  7.000e-38 27  Burkholderia fungorum LB400 gi|48785139||ref|ZP_00281444.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 179 ................VERGTLLDLAAIENGAYLVAANNQHFGPASQMLMPGRGINMG----------DGWETRRRREPGNDWAIVALARPGV-IRKIDVDTAHFKGNFPDRCSLQAASVTGGDDSLVTQAMFWPVLLGEQKLQMDHVHTFA-DNLASLGPVTHVRFNIFPDGGVSRLRLWGEI............................................................................................................................................................... 335
84  1.000e-37 33  Burkholderia cepacia R1808 gi|46318939||ref|ZP_00219364.1| COG4266: Allantoicase [Burkholderia cepacia R180 protmod 177 ..............AGASATEQFDLAAMENGGYVVAANNQHFGLASNLL-------LPGRGVNMG---DGWETRRRREPGNDWAIVALAQPGV-IRRIEVDTAFFKGNYPDRCSIQAAYMSGGTDSLITQSMFWPVLLGEQKLQMDKQHFFEPEIAAL-GPVTHVRLNIIPDGGVSRLRLWGT................................................................................................................................................................ 334
85  1.000e-37 31  Pseudomonas fluorescens PfO-1 gi|48732007||ref|ZP_00265751.1| COG4266: Allantoicase [Pseudomonas fluorescens P protmod 172 ...............AVGDNEQVDLAAALNGGRALACSDEHFGRMSNILNPGRGINMG----------DGWETARRRTPGNDWVIVALGHPG-EIEKIIVDTLHFKGNYPDTCSIQGAFVKGGTDSIETQSLFWRELLPSQKLEMHAEHTFEQINALG--PITHIRLNVFPDGGVSRLRVLGKVAK............................................................................................................................................................. 331
86  2.000e-37 30  Azotobacter vinelandii gi|53612899||ref|ZP_00092119.2| COG4266: Allantoicase [Azotobacter vinelandii] protmod 172 ...............AVGADETLDLAAALNGGRALACSDEHFGRMGNLLNPGR-----------GANMDGWETARRRTPGNDWVIVALGHPG-EIERIVVDTLHFKGNYPDSCSIQAAWVKGGTDSIETQSLFWRELLPSQKLSMHREHEF-VEEIRPLGPISHVRLNVFPDGGVSRLRLFGKVAK............................................................................................................................................................. 331
87  5.000e-37 32  Burkholderia pseudomallei K96243 gi|53719727||ref|YP_108713.1| putative allantoicase [Burkholderia pseudomallei K protmod 177 ..............AGASRSALFDLAAMENGGYVVAANNQHFGLASNVL-------LPGRGVNMG---DGWETRRRREPGNDWAIVALAQPGV-IRKVEIDTAHFKGNYPDRCSIQAAYVQGGTDSLVTQAMFWPVLLGEQKLQMDKQHAFEAELAAL-GPVTHVRLNIIPDGGVSRLRVWGT................................................................................................................................................................ 334
88  7.000e-37 29  Ralstonia solanacearum gi|17430297||emb|CAD17062.1| PUTATIVE ALLANTOICASE (ALLANTOINE AMIDINOHYDROLASE) protmod 180 .................DRATLFDLAAMENGAYVVEVNNQHFGLASSLLMPGRGINMG----------DGWETRRRREPGNDWCIIALAHPG-RIRKIEVDTAHFKGNFADRVSLQAARVTGGTDALKTQAMFWQTLLPEQKLQMDHQHYYE-AELADLGPVTHVRFNMFPDGGVSRLRLWG................................................................................................................................................................. 333
89  8.000e-37 26  Rattus norvegicus gi|34863241||ref|XP_216673.2| similar to allantoicase [Rattus norvegicus] protmod 174 ..............AALDSTEPVDLVAIAFGGVCVGFSNAHFGHPNNMIEPHEPDSVLKGVGDPKSIADGWETARRQVPGCEWAVFRLAHPGV-ITQIEIDTKYFKGNSPDSCKVDGCILTEEEDMIRQKAHKWKPLLPVTKLTPNQNHLLDSLTLELQDVITHARITIAPDGGVSRLRLKG................................................................................................................................................................. 364
90  2.000e-36 26  Rattus norvegicus gi|50926129||gb|AAH78971.1| Unknown (protein for MGC:93851) [Rattus norvegicus] protmod 207 ..............AALDSTEPVDLVAIAFGGVCVGFSNAHFGHPNNMIGVGDPKSIA----------DGWETARRQVPGCEWAVFRLAHPGV-ITQIEIDTKYFKGNSPDSCKVDGCILTEEEDMIRQKAHKWKPLLPVTKLTPNQNHLLDSLTLELQDVITHARITIAPDGGVSRLRLKG................................................................................................................................................................. 384
91  1.000e-35 35  Neurospora crassa gi|28881101||emb|CAD70499.1| allantoicase [Neurospora crassa] gi|32415553|ref|XP protmod 26 ...............................................................................................................................................................................................RSSTIDLISGALGGKVLGFSDEWFAEAANLLQPGKMVYTGDGWET-RRHNPAEFDWVVIRLGVASGTVEGVEIDTAFFNGNHAPAISVEGCFSQNDDEVKGERGGWETILGVQECGPSQRFGWKLENKKQYTHVRLNMYPDGGIARFRLFGH 191
92  1.000e-35 34  Sinorhizobium meliloti 1021 gi|16264535||ref|NP_437327.1| putative allantoicase protein [Sinorhizobium melil protmod 177 ..................ANETIDLASCLLGGRIVAFSNGHYGH-ERLIAPGR-----------GANMDGWETRRRREPGYDWIIVKLAARG-HVERILVDTAHFKGNYPDACSLQAADLGGMTAEVASSAMFWNELLPHRKLSADSVHEYGSDMLRHADPVTHVRLNIYPDGGVSRLRIYGRV............................................................................................................................................................... 334
93  1.000e-35 28  Burkholderia fungorum LB400 gi|48788433||ref|ZP_00284412.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 171 ........QPQVDWAGASRTEQFDLAAMENGAYLVAANNQHFGAASTILMP-------GRGVNMG---DGWETRRRREPGNDWAIVALAQPGV-IRKIEVDTAHFKGNYPDRCSIQAAYVTGGTDSLITQAMFWPVLLGEQKLKMDNQHYFESEIAAL-GPVTHVRFNIIPDGGVSRLRLWGT................................................................................................................................................................ 334
94  2.000e-35 30  Pseudomonas syringae pv. tomato str. DC3000 gi|28854072||gb|AAO57137.1| allantoicase [Pseudomonas syringae pv. tomato str. D protmod 173 ................VTESEQIDLVAALNGGRSIACSDEHYGSMSNILNP-------GRGVNMG---DGWETARRRTPGNDWVIVALGHKG-EVEKVIVDTLHFKGNYPDSCSIQGAFVKGGTDSIETQSLFWRELLPSQKLTMHAEHEFEQVKAIG--PITHIRLNVFPDGGVSRLRVLGKVSR............................................................................................................................................................. 331
95  3.000e-35 25  Homo sapiens gi|40548427||ref|NP_060906.2| allantoicase isoform a [Homo sapiens] gi|20987689| protmod 208 ...............ATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMA----------DGWETARRLDPGCEWAVFRLAHPGV-ITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVIRQKHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSRLRLRG................................................................................................................................................................. 383
96  4.000e-35 30  Pseudomonas syringae pv. syringae B728a gi|23469110||ref|ZP_00124445.1| COG4266: Allantoicase [Pseudomonas syringae pv. protmod 173 ................VSADEQIDLVAALNGGRSIACSDEHYGSMSNILNP-------GRGVNMG---DGWETARRRTPGNDWVIVALGHKG-EVEKVIVDTLHFKGNYPDSCSIQGALVKGGTDSIETQSLFWRELLPSQKLTMHAEHEFA-EQIKAIGPITHIRLNVFPDGGVSRLRVLGKVAR............................................................................................................................................................. 331
97  6.000e-35 35  Ustilago maydis 521 gi|46097147||gb|EAK82380.1| hypothetical protein UM01926.1 [Ustilago maydis 521] protmod 202 .................SAFNLLDLAHCLNGGRVVFTDDNHFGAGSNIILPGR-----------GKDMDGWETRRSRAKGHNWSIVKLGEPG-FLSYAEVDTAHFLGNFPESTEILGTV--HDSATVPSADAQWVTLLPRTKLGPGRRHFFPLVDG-NSAPFTHVMIKMHPDGGIKRFRVHGR................................................................................................................................................................ 354
98  6.000e-35 37  Gibberella zeae PH-1 gi|42552795||gb|EAA75638.1| hypothetical protein FG05993.1 [Gibberella zeae PH-1 protmod 34 ...................................................................................................................................................................................................IDLISSGLGGKVLDYSDQWFCEASNLLNPGKMVFTGDGWETRRNQEP--FDYAIIKLGVASGTIEGLEIDTAFFNGNHAPAISVEGVFSQDDDKVVGGRGEWETILGIQECGPSQRFAWKLKTHGAYTHVRLNMYPDGGIARFRLFGH 195
99  1.000e-34 28  Burkholderia fungorum LB400 gi|48780954||ref|ZP_00277614.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 178 ................IAPDAELDLASAMNGARIVAANNQHYGLASNLLLPTRAANIG----------EGWETRRRREPGCDWCIVELAVPG-EISRVDVDTAHFKGNFADRCSLQGAFVAGTDESLITQSMFWPVLLDEQKLEMDRLHSFA---PERIAPVSHVRFNILPDGGVSRLRLIGRALP............................................................................................................................................................. 334
100  1.000e-34 34  Neurospora crassa gi|101840||pir||A35829 allantoicase (EC 3.5.3.4) - Neurospora crassa gi|168749|g protmod 26 ...............................................................................................................................................................................................RSSTIDLISGALGGKVSGFSDEWFAEAANLLQPGKMVYTGDGWET-RRHNPAEFDWVVIRLGVASGTVEGVEIDTAFFNGNHAPAISVEGCFSQNDDEVKGELGGWETILGVQECGPSQRFCWKLENKKQYTHVRLNMYPDGGIARFRLFGH 191
101  3.000e-34 29  Burkholderia fungorum LB400 gi|48785542||ref|ZP_00281792.1| COG4266: Allantoicase [Burkholderia fungorum LB4 protmod 177 ...............DLSPGVELDLASATNGARIVAANNEHYGAASNLLLPTRAANMG----------EGWETRRRREPGCDWCIIELATPG-EISQISVDTAHFKGNFADRCSLQGAWVAGTDESLITQSIFWPVLLDEQKLEMGRVHTFV---PTQSMPVTHVRFNILPDGGVSRLRLIGR................................................................................................................................................................ 331
102  3.000e-34 33  Xenopus muelleri gi|21667357||gb|AAM74036.1| allantoicase [Xenopus muelleri] protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRIPGH-DWCIIELGV-PGIIHGFEADTRFFTGNYAPRISVQAACLKPEEADKLKSQKWNHLLKMTELKPGSHNYFQVNSKERWTHLRLNIYPDGGIARFKIYG. 134
103  4.000e-34 34  Acinetobacter sp. ADP1 gi|50086496||ref|YP_048006.1| allantoicase [Acinetobacter sp. ADP1] gi|49532472| protmod 12 ............................................................................................................................................................................................PTSLHSLTNLADSRIGAQIVECSDDFFAEAKRMLQEDKFDDHGDGWETRRKRHAGY-DWCIVKLGV-AGKIKAVDIDTTFFTGNYPASASLEGCYA---PNGNTQEALWQPLLGNSILGPSQHHVFDVQNDAIFTHIRLNIFPDGGVARLRIYG. 170
104  5.000e-34 35  Xenopus tropicalis gi|21667347||gb|AAM74031.1| allantoicase [Xenopus tropicalis] protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRIPGH-DWCIIELGV-PGIIHGFEADTRFFTGNYAPRISVQAACLKPEEADKLKSEKWSHLLQMTELTPGSSHYFNVNSKQRWTHLRLNIYPDGGIARFKVYG. 134
105  9.000e-34 26  Plasmodium falciparum 3D7 gi|23612655||ref|NP_704216.1| hypothetical protein [Plasmodium falciparum 3D7] g protmod 2381 ....................KTINVCNILDGANIVYTTDEFYGKSENIL-----------IDHNSEYVMGWQTRRNRPLRYNYCIIKLS-YITNIKYIEINTIFYEYNSPLCVSIDSCNLKEIHPQEKTKNIQWVQLLPLSYIKGNHINFFSINKILNKTISTHLRLNIYPDGGINTIKVYGTVLED............................................................................................................................................................2569
106  1.000e-33 26  Mus musculus gi|16716445||ref|NP_444386.1| allantoicase [Mus musculus] gi|9255889|gb|AAF86348 protmod 208 ..............AALGSTEPVDLVAIAFGGVCVGFSNAHFGHPNNMIGVGEPKSIA----------DGWETARRLDPGCEWAVFRLAHPGV-ITQIEIDTKYFKGNCPNSCKVDGCILTEEEDMIRHNAHKWKSLLPVTKLIPNQNHLLDSLTLELQDVITHAMITIAPDGGVSRLRLKG................................................................................................................................................................. 385
107  4.000e-33 34  Litoria infrafrenata gi|21667353||gb|AAM74034.1| allantoicase [Litoria infrafrenata] protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRIPGH-DWCIIELG-IPGVIHGLYVDTHFFTGNYAPRVSVQVACLPEKAVERLHSEKWEYLLKMTELKPGYCNYFNVSSKGRWTHIRLNIYPDGGIARFKVYG. 133
108  7.000e-33 30  Aspergillus nidulans FGSC A4 gi|40744499||gb|EAA63675.1| hypothetical protein AN3104.2 [Aspergillus nidulans protmod 5 ......................................................................................................................................................................................TFVPSEDIDKAHTTNLASAALNSKVLACSNDYFAAASNLLTPTPPINRPDGWETRRHNPDPY-DWVVIKLGVASGAIQGVEVDTGFFVGNYGEKAELQATYAPSDAEVADPSSGWTTILPPQECGPSQRNSYDAANPTPYTHVRLLMYPDGGFGRLRLYGH 184
109  1.000e-32 34  Ciona intestinalis gi|21667351||gb|AAM74033.1| allantoicase [Ciona intestinalis] protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRIPGH-DWCIIELG-IPGVIHGLYVDTHFFTGNYAPRVSVQVACLPEKAVERLHSEKWEYLLKMTELKPGYCNYFNVSSKGRWTHIRLNIYPDGGMARFKVYG. 133
110  1.000e-32 40  Rattus norvegicus gi|21667355||gb|AAM74035.1| allantoicase [Rattus norvegicus] protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRIPGH-DWCVIQLGIQ-GIIRGIDVDISYFSGNYAPRMSIQAANLSEDTVTNIPSHSWDYLVPMSELKPDSSHYFFVNSQQRWTHIRLNIFPDGGVARLRVYG. 135
111  1.000e-32 31  Homo sapiens gi|14718648||gb|AAK72970.1| allantoicase [Homo sapiens] protmod 1 ..................................................................................................................................................................................................................TDDFFAPAENLIKSDSPCKWMDGWETRRKRIPGH-DWCVLRLGIQ-GVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPSDDWSYLVPMTELKPGNHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFG. 166
112  3.000e-32 35  Bufo marinus gi|27777725||gb|AAM74032.2| allantoicase [Bufo marinus] protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRIPGH-DWCIIELGV-PGVIHGFHVNTRFFTGNYAPRISVQVACLQEKAVERLYSEKWEYLLKMTELTPGSCHYFHVASKERWTHIRLNIYPDGGIARFKVYG. 133
113  4.000e-32 22  Plasmodium yoelii yoelii gi|23486503||gb|EAA20813.1| hypothetical protein [Plasmodium yoelii yoelii] protmod 2194 ......................INVSNILDGSNVVYTTDEFYGKSDNIL-----------IDQNSKYVMGWQTRRNRPLRYNYCIIKLS-YITNVKYIEINTIFYEYNFPLCISIDHCYVSDIHAEEKSKQMKWKELLPLSYIKGNHINYFFNDESSNSLPSSHLRLNIYPDGGINTIKVFGTV...............................................................................................................................................................2377
114  5.000e-32 22  Plasmodium berghei gi|56500289||emb|CAH95622.1| conserved hypothetical protein [Plasmodium berghei] protmod 1264 ......................INVSNILDGSNVVYTTDEFYGKSDNIL-----------IDQNSKYVMGWQTRRNRPLRYNYCIIKLS-YITNVKYIEINTIFYEYNFPLCISIDHCYVNDIHAEEKSKQMKWKELLPLSYIKGNHINYFFNDESSNSLPSSHLRLNIYPDGGINTIKVFGTV...............................................................................................................................................................1447
115  5.000e-31 26  Pan troglodytes gi|55594433||ref|XP_525676.1| PREDICTED: similar to allantoicase isoform a; alla protmod 322 ...............ATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMA----------DGWETARRLDPGCEWAVFRLAHPGV-ITRIEIDTKYFEGNAPDSCKVDGCILQEEEAVIKQKAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSRLRLWG................................................................................................................................................................. 533
116  4.000e-30 28  Homo sapiens gi|7677260||gb|AAF67097.1| putative allantoicase [Homo sapiens] protmod 3 ....................................................................DGWETARRLDPGCEWAVFRLAHPGV-ITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVIRQKHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSRLRLRG................................................................................................................................................................. 135
117  4.000e-30 30  Homo sapiens gi|55824666||gb|AAH35356.1| Allantoicase, isoform b [Homo sapiens] gi|40548425|r protmod 3 ....................................................................DGWETARRLDPGCEWAVFRLAHPGV-ITRIEIDTKYFEGNAPDSCKVDGCILQEEEAVIRQKAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSRLRLRG................................................................................................................................................................. 136
118  5.000e-30 27  Cryptococcus neoformans var. neoformans B-3501A gi|50258337||gb|EAL21026.1| hypothetical protein CNBD4020 [Cryptococcus neoforma protmod 200 ....................QPTNLLSPLIGGRIISCSDAQFSPPGNLLLPGRGVDMS----------DGWETRRNRGKYAEWAVAKLGVPGI-VRWVEVDTAFHPGNYPKYCAVEATLSSDEDLS----SASWTTIVRKTPCGAHRQHYLPLENVPPTQVFSHIRYSVFPDGGTKRVRIFGHPLDPTSPDAQGALEKARLE............................................................................................................................................. 381
119  8.000e-30 39  Burkholderia cepacia gi|12744600||gb|AAK06709.1| allantoicase [Burkholderia cepacia] protmod 1 .......................................................................................................................................................................................................................................................................VDTAFFKGNFPDRCSLQAAHVTTDDSLVTQAMFWAELLGEQKLQMDHVHTFQLAALGPVTHVRFNIFPDGGVSRLRLWG. 82
120  8.000e-30 39  Schizosaccharomyces pombe gi|1067211||emb|CAA91956.1| SPAC1F7.09c [Schizosaccharomyces pombe] gi|1351910|s protmod 193 .......................DLAHMYLGGLVVQCSDQHFGKKDNLL-------LPGRGVNMG---DGWETARSREKGHDWVIVKLGARG----YIDIDTNHFKGNYPKEVILEAI---DSPDHIPGPDAQWVTILPARKLGPHMEHVFTNL-QNNSTPMTHVRMIIIPDGGVKRLRIYGR................................................................................................................................................................ 338
121  1.000e-29 35  Anopheles gambiae str. PEST gi|55240877||gb|EAA09264.3| ENSANGP00000012342 [Anopheles gambiae str. PEST] gi| protmod 1 .......................................................................................................................................................................................................................................DGWETRRKRTPGH-DWCLVELGAPTQ-IAGVMIDTAFFTGNYVPRVSIQAGTLDTDEVQLIGTDQWDVLVPRTELQPTRRHYFTVAKSLIVNHLRVNMFPDGGIARLRVYG. 145
122  2.000e-29 27  Tetraodon nigroviridis gi|47213097||emb|CAF89517.1| unnamed protein product [Tetraodon nigroviridis] protmod 206 ................VSAHEDVDLVALPNGGVCLGFSNAHFGHPRNMI----------GLGQAASMADGWETARRLDAGWEWAVFRLGHPGT-VHTVEVDTRHFKGNSPDSCWVEACSLSPAEEVTGWTSGTWCLLLPPQKLRPHHRHLFGEQQLRWSAPVTHVRLLISPDGGVSRLRLWGRV............................................................................................................................................................... 381
123  6.000e-29 28  Xenopus laevis gi|4929823||gb|AAD34169.1| allantoicase [Xenopus laevis] gi|9910617|sp|Q9W6S5|AL protmod 210 ..................PNDFEDLLSMVNGGVCLGFSDAHYGHPRNLI-------GNGRACDMG---DGWETARRQVPGFEWAVLKLGHPGLVTH-IEIDTNHFKGNSPNSCKIDACALKPTEQEEVEQGYNWKPLLPVTQIHPHKRHFMESTSLALHQVISHVKITIAPDGGVSRIRLWGFPRP............................................................................................................................................................. 387
124  6.000e-29 28  Xenopus laevis gi|38014420||gb|AAH60404.1| MGC68581 protein [Xenopus laevis] protmod 210 ..................PNDFEDLLSMVNGGVCLGFSDAHYGHPRNLI-------GNGRACDMG---DGWETARRQVPGFEWAVLKLGHPGLVTH-IEIDTNHFKGNSPNSCKIDACALKPTEQEEVEQGYNWKPLLPVTQIHPHKRHFMESTSLALHQVISHVKITIAPDGGVSRIRLWGFPRP............................................................................................................................................................. 387
125  2.000e-28 28  Danio rerio gi|50540500||ref|NP_001002716.1| zgc:91799 [Danio rerio] gi|49904277|gb|AAH76445 protmod 212 .....................LVDLVALVNGGVCVGFSDAHYGHPRNMIGLGMAENMG----------DGWETARRQVPGSEWAIFRLGHPGI-ISKIELDTNHFKGNFPDSCRIEACSLTEDEENSSDRSPMWNILLPPQKMKAHHRHVFSGPSLVHCGPVSHVRMVIAPDGGISRLRIWGRPV.............................................................................................................................................................. 386
126  3.000e-28 28  Danio rerio gi|55251108||emb|CAH68966.1| novel protein similar to vertebrate allantoicase (A protmod 212 .....................LVDLVALVNGGVCVGFSDAHYGHPRNMIGLGMAENMG----------DGWETARRQVPGSEWAIFRLGHPGI-ISKIELDTNHFKGNFPDSCRIEACSLTEDEENSSDRSPMWNILLPPQKMKAHHRHVFSGPSLVHCGPVSHVRMVIAPDGGISRLRIWGRPV.............................................................................................................................................................. 386
127  2.000e-27 22  Homo sapiens gi|14718648||gb|AAK72970.1| allantoicase [Homo sapiens] protmod 174 ...............ATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMA----------DGWETARRLDPGCEWAVFRLAHPGV-ITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVIRQKHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLT............................................................................................................................................................................... 335
128  3.000e-27 28  Xenopus tropicalis gi|51950119||gb|AAH82508.1| Unknown (protein for MGC:89169) [Xenopus tropicalis] protmod 210 ..................PNDLEDLLSMVNGGVCLGFSDAHYGHPRNLI-------GIGRACDMG---DGWETARRQVPGFEWAVLKLGHPGLVTH-IEIDTNHFKGNSPNSCKIDACALTPTEEEGVKRDERWKPLLSVTQIHPHKRRYVESTSLALHQVISHVKITIAPDGGVSRIRLWGFPRP............................................................................................................................................................. 387
129  3.000e-27 29  Debaryomyces hansenii CBS767 gi|49652955||emb|CAG85291.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 186 .................DSTTILDTASVLNGGVAIDRSDQHFGTADNLL-------LPGRGHDMG---DGWETKRSREPGHDWVVIRLG-ASTKISSVLVDTLHFRGNFPQKINVKAIKVVNDKEIPRFDSDKWDLLVGDSKTGPDKELEFKV---SGDKVYSHVLFTMIPDGGVKRVRVFGNIVSN............................................................................................................................................................ 342
130  8.000e-27 26  Branchiostoma belcheri tsingtaunese gi|32396164||gb|AAP41914.1| allantoicase [Branchiostoma belcheri tsingtaunese] protmod 204 ................VKSNELVDLVAMDNGGVCLGFSNAHYGHPRNAI-------GLGRADNMG---DGWETARRLDPGCEWAVYRLGHPGVILK-IEIDTNHFKGNYPDSCRIEACTLSPTEEKAVNEEVKWKTLLGPTKLSAHRRLFLSGGQVQPVGVVSHVRLTMTPDGGISRMRLWGFSRAPNPA......................................................................................................................................................... 390
131  2.000e-26 24  Plasmodium chabaudi gi|56526065||emb|CAH77945.1| conserved hypothetical protein [Plasmodium chabaudi protmod 663 ......................INVSNILDGSSVVYTTDEFYGKSDNIL-----------IDQNSKYVMGWQTRRNRPLRYNYCIIKLS-YIANVKYIEINTIFYEYNFPLCVSIDHCYISDIHAEEKSKQMKWKELLPLSYIKGNHINYFTINPAAFNDLSSHLRLNIYPDGGINTIKVFGTV............................................................................................................................................................... 846
132  7.000e-26 33  Nocardia farcinica IFM 10152 gi|54027211||ref|YP_121453.1| putative allantoicase [Nocardia farcinica IFM 1015 protmod 188 .....................PVDLAALENGALVLDCSDRFYGSPHQLLHPGNARRMG----------DGWETARRRDDGNDWVRIRLAGPG-LIRLAELDTSYFLGNSPAAARLTGRTTDGTE----------VELLPRTPLQPDTRHRFP--TAAVAASVEEVRLDIYPDGGLARVRLFGE................................................................................................................................................................ 326
133  1.000e-25 29  Plasmodium chabaudi gi|56503427||emb|CAH85074.1| hypothetical protein PC301393.00.0 [Plasmodium chab protmod 32 .............................................................................................................................NTLHKKYQWISILEDERMNPNYNHNCFNINTCNK-IFTHLIVCLLPDGGINKLRVYGEIISKNVKQKNKIINVSNILDGSSVVYTTDEFYGKSDNILI-DQNSKYVMGWQTRR......................................................................................................... 148
134  6.000e-25 35  Kluyveromyces lactis NRRL Y-1140 gi|50303575||ref|XP_451729.1| unnamed protein product [Kluyveromyces lactis] gi| protmod 32 ............................................................................................................................................................................................................GQVISFSDQWFADAANLLTPTAPVRDADGWETRRHNTEEY-DWVIIKAGVYAARIIGCEVDTAYFNGNHAPAIAVQGLYSEGEETLSENDSRWTDVIEKVECGPSQRHFF-LRDSLTESHFKLKMFPDGGIARFRLYG. 184
135  6.000e-24 22  Plasmodium falciparum 3D7 gi|23509606||ref|NP_702273.1| hypothetical protein PF14_0384 [Plasmodium falcipa protmod 87 ............NINDVDFFNFNNVLSKHYGSRIIFVTDDSISKSENILVEDDKV--------------GWITRRRRDVGHEWLIIKLKHPCI-IYGIELNFDNIAEDVCPHLSIEVSNNNAIDDIIKEE..................................................................................................................................................................................................................... 189
136  3.000e-22 31  Aspergillus nidulans FGSC A4 gi|40744499||gb|EAA63675.1| hypothetical protein AN3104.2 [Aspergillus nidulans protmod 204 .......................ELSSALLGGLALGASDQHYTPCSNLLLPGR-----------GKDMDGWETARSRAKGHDWAVIKLGLPG-SVSKVVVDTKDFRGNFPRAVRVHGAGSVGSDEVPAHDHAGWTEIVGDKPCQADTEHVFEGADAADSGIFTHAKLTLVPDGGVKRFRVFGK................................................................................................................................................................ 357
137  3.000e-21 30  Burkholderia cepacia gi|12744600||gb|AAK06709.1| allantoicase [Burkholderia cepacia] protmod 1 ...................................................................................................VDTAFFKGNFPDRCSLQAAHVTGGDDSLVTQAMFWAELLGEQKLQMDHVHTFDQLAALG--PVTHVRFNIFPDGGVSRLRLWGEP............................................................................................................................................................... 84
138  5.000e-20 25  Plasmodium berghei gi|56492376||emb|CAI04950.1| conserved hypothetical protein [Plasmodium berghei] protmod 96 ..........................................................................................................................................................................................................FGAKVLFVTDESISKSENLIIEDK-----TGWVTRRRRDVGH-EWLIFKLKY-PSIIYGIELDNKEAKYSFLESYKIDKSISDLLENQNTP---WVELLQAKQCNKKKIYYFKINDQKPWTHIRINLYPDGGINKINFYG. 277
139  6.000e-19 25  Danio rerio gi|55251109||emb|CAH68967.1| novel protein similar to vertebrate allantoicase (A protmod 2 ..............................................................................................................................................................................................................VIFATDEWFAPARNLLKRDPPEKWMDGWETRRKRIP----------------------------GNYAPFASIQATCLDQEAVAQLNSDSWKEVVPVTKLKADTCHYLSVSYPHRVTHIRFNIYPDGGIARLKVYG. 143
140  1.000e-18 27  Plasmodium chabaudi gi|56506987||emb|CAH85802.1| conserved hypothetical protein [Plasmodium chabaudi protmod 4 ........................................................................................................................................................................................................................................GWVTRRRRDVGH-EWLIFKLKY-PSIIYGIELDNKDVKYNFLESYKIDKSISDLLENQNTP---WVELLQAKQCNKKKIYFFKINDQKPWTHIRINLYPDGGINKINFYG. 160
141  2.000e-14 32  Plasmodium yoelii yoelii gi|23486503||gb|EAA20813.1| hypothetical protein [Plasmodium yoelii yoelii] protmod 1747 ....................................CDDYNFDEKNDLIGKNEECNKFSQFEEVSKYREGWLTKRRIKKYFDFCIVKLCKP-TLIKGIDIDTNNFLGNYAPYVSIEGAYIEDDDLMSSEAFSKYVE...............................................................................................................................................................................................................1848
142  3.000e-14 31  Plasmodium chabaudi gi|56526065||emb|CAH77945.1| conserved hypothetical protein [Plasmodium chabaudi protmod 217 ....................................CDDYSFDEKSDLIRKNEESNEFSQFEEVPKYREGWLTKRRIKKYFDFCIVKLCKP-TLIKGIDIDTNNFLGNYAPYVSIEGAYIEDDDLMSSAAFSKYVE............................................................................................................................................................................................................... 318
143  7.000e-14 32  Plasmodium berghei gi|56500289||emb|CAH95622.1| conserved hypothetical protein [Plasmodium berghei] protmod 817 ....................................CDDYNFDEKSDLIGKNEECNEFNQFEEVSRYREGWLTKRRIKKYFDFCIVKLCKP-TLIKGIDIDTNNFLGNYAPYVSIEGAYIEDDDLMSSEAFSKYVE............................................................................................................................................................................................................... 918
144  4.000e-12 43  Plasmodium falciparum 3D7 gi|23612655||ref|NP_704216.1| hypothetical protein [Plasmodium falciparum 3D7] g protmod 1949 .....................................................................GWLTKRRIKKYFDFCVIKLCKP-TLIKGIDIDTNNFLGNYAPYISIEGAYIEDE............................................................................................................................................................................................................................2001
145  4.000e-09 33  Plasmodium berghei gi|56500289||emb|CAH95622.1| conserved hypothetical protein [Plasmodium berghei] protmod 853 ........................................................................................................................................................................................................................................GWLTKR-RIKKYFDFCIVKL-CKPTLIKGIDIDTNNFLGNYAPYVSIEGAYIEDDD....................................................... 906
146  4.000e-09 33  Plasmodium chabaudi gi|56526065||emb|CAH77945.1| conserved hypothetical protein [Plasmodium chabaudi protmod 253 ........................................................................................................................................................................................................................................GWLTKR-RIKKYFDFCIVKL-CKPTLIKGIDIDTNNFLGNYAPYVSIEGAYIEDDD....................................................... 306
147  4.000e-09 33  Plasmodium yoelii yoelii gi|23486503||gb|EAA20813.1| hypothetical protein [Plasmodium yoelii yoelii] protmod 1783 ........................................................................................................................................................................................................................................GWLTKR-RIKKYFDFCIVKL-CKPTLIKGIDIDTNNFLGNYAPYVSIEGAYIEDDD.......................................................1836
148  1.000e-08 41  Plasmodium falciparum 3D7 gi|23612655||ref|NP_704216.1| hypothetical protein [Plasmodium falciparum 3D7] g protmod 1949 ........................................................................................................................................................................................................................................GWLTKR-RIKKYFDFCVIKL-CKPTLIKGIDIDTNNFLGNYAPYISIEGAYIEDE........................................................2001
149  1.000e-07 41  Canis familiaris gi|57098091||ref|XP_532860.1| PREDICTED: hypothetical protein XP_532860 [Canis f protmod 14 ................LDFTQLVDMASESVGGQVLFATDDFFAPAENLIK..................................................................................................................................................................................................................................................................................................... 47
150  2.000e-06 28  Danio rerio gi|55251109||emb|CAH68967.1| novel protein similar to vertebrate allantoicase (A protmod 157 .....................LVDLVALVNGGVCVGFSDAHYGHPRNMIGLGMAENMG----------DGWETARRQVPGSEWAIFRLGHPGI-ISKIELDT................................................................................................................................................................................................................................................. 241
151  3.000e-06 28  Plasmodium chabaudi gi|56503427||emb|CAH85074.1| hypothetical protein PC301393.00.0 [Plasmodium chab protmod 107 ......................INVSNILDGSSVVYTTDEFYGKSDNIL-----------IDQNSKYVMGWQTRR............................................................................................................................................................................................................................................................................ 148
152  8.000e-06 26  Plasmodium falciparum 3D7 gi|23509606||ref|NP_702273.1| hypothetical protein PF14_0384 [Plasmodium falcipa protmod 431 ....................................................................................IFKFGVRGI-VENFTIDIGNYKYDHPECIQIDILTLNEEDEKLLKKKMEWIQ-LPPFKITTNQKKTFFHFNTLMERTATHFKISIHPDGGISQINVIGTV............................................................................................................................................................... 548
153  3.000e-05 30  Plasmodium falciparum 3D7 gi|23509606||ref|NP_702273.1| hypothetical protein PF14_0384 [Plasmodium falcipa protmod 105 ...........................................................................................................................................................................................................GSRIIFVTDDSISKSENILV----EDDKVGWITRRRRDVGH-EWLIIKLK-HPCIIYGIELN.............................................................................. 160
154  2.000e-04 23  Plasmodium yoelii yoelii gi|23478061||gb|EAA15248.1| allantoicase, putative [Plasmodium yoelii yoelii] protmod 353 .................................................................................NFAIFKFGVRGI-IENFTIDIGNYKHDHPETIQIDLLTLDEDDEKLAKKKIDWFQ-LPPCKINTGQKKTFYNFNLLMERTATHFKISIHPDGGISQVNIIGTVLSIPP.......................................................................................................................................................... 478
155  2.000e-04 31  Rattus norvegicus gi|21667355||gb|AAM74035.1| allantoicase [Rattus norvegicus] protmod 142 ..............AALDSTEPVDLVAIAFGGVCGGFSNAHFGHPNNMIGVGDPKSIA----------DGWETAR............................................................................................................................................................................................................................................................................ 192



Contact us