Homologs of:

1vrm_A mol:protein Hypothetical Protein Tm1553
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# E-value %id Organism Protein Model Start RTKDQYYELRDFALGTSVRIVVSSQKINPRTIAEAILEDXKRITYKFSFTDERSVVKKINDHPNEWVEVDEETYSLIKAACAFAELTDGAFDPTVGRLLELWGFTGNYENLRVPSREEIEEALKHTGYKNVLFDDKNXRVXVKNGVKIDLGGIAKGYALDRARQIALSFDENATGFVEAGGDVRIIGPKFGKYPWVIGVKDPRGDDVIDYIYLKSGAVATSGDYERYFVVDGVRYHHILDPSTGYPARGVWSVTIIAEDATTADALSTAGFVXAGKDWRKVVLDFPNXGAHLLIVLEGGAIERSETFKLFEREEnd
0.000e+00 30  Photobacterium profundum SS9 gi|54308024||ref|YP_129044.1| Putative thiamin biosynthesis lipoprotein ApbE [Ph protmod 24 ..QRELIHLNGSTMGTYYSIKLIKQEPAATDIQAEIDRRLELVNDQMSTYRKHSELSQFNQHTNEPFTVSADTAKVVKESLRLSELTNGAYDVTVGPIVNLWSFGPEARPEATPTDEELNKRREIIGYHHLKVDGNKLIKDI-PDLYVDLSSIAKGFGVDVVADYF-DELGVPDYLVEIGGELSVKGNNLEGIPWRIAVEKPTEDGVQEIIEPGDMAVATSGDYRNYFEEDGIRYSHLINPKTGKPANHVVSVTVLHPSSMTADAYATAFSVMGEEESIKL-ANEENLPILLVIKTENGFKEYSDDFVPY... 336
0.000e+00 36  Thermoanaerobacter tengcongensis MB4 gi|20808837||ref|NP_624008.1| Membrane-associated lipoprotein involved in thiami protmod 26 ....QPISDTKFALDTYCTLTVYDKVP--KKVLDDGFKAIEDIEKKMSVTIEDSEVSEINKNAGRPVKVSPDTFYVIKKAIHFSEIEKGYFDITVGPIVNLWNIGTDK--ARVPSAEEIKAKLPLVNYKNIVLDEKNMTVMLKKGMSIDLGGIAKGYAADKVAEV-LKKEGVKHAIINLGGDVLTIGTKPDGTNWRVGIQTPFKPEYFGIVEVGEKAVVTSGIYERYFEKDGKLYHHILNPFTGYPANHLYSVTIITDTSIDGDALAK-IFVMGLDEGLKVAENLP--GVEAIFVTDDKKVYITSGLK..... 326
0.000e+00 28  Vibrio vulnificus YJ016 gi|37680768||ref|NP_935377.1| thiamin biosynthesis lipoprotein ApbE [Vibrio vuln protmod 21 ...AEQVHLSGPTMGTTYNIKYITQEPKPDVLQQEVDRLLEEVNDQMSTYRKTSELSRFNQSDSAPFAVSQQTATVVKEAIRLNHLTLGALDVTVGPLVNLWGFGPEARRDVVPSAEDLAERKAQTGIEHLSVVDNTLIKTL-PNLYVDLSTIAKGWGVDVVADYIQSQ-GVQNYMVEIGGEIRLKGVNREGVPWRIAIEKPEERAIQDIIEPGDMAIATSGDYRNYFERDGIRYSHIINPKTGMPIHKVVSVTVLDKSSMTADGLATGLMVLGAEKGIEIANQ-NSIPVLMIVKTDDGFTEASDAYKPY... 331
0.000e+00 30  Mannheimia succiniciproducens MBEL55E gi|52424358||ref|YP_087495.1| ApbE protein [Mannheimia succiniciproducens MBEL55 protmod 26 ...PEIITLSGKTMGTTYHIKYIDDGGNAEQAQEQIESILKDVNDKMSTYIPNSELSRFNQYKNQPVEISADLAKVIKEAVRLNKITEGALDVTVGPLVNLWGFGPEKRIDKQPSATQLEERRAWVGIEKLALTEQAGKFTLAKAVYIDLSSIAKGFGVDQVADYVES-IGAKNYMSEIGGEIRAKGKNIEGKDWQIAIEKPNFDGVQDILGLKDLAMATSGDYRNYFEENGMRFSHEINPQTGKPIHKLASITVLSPSTMTADGLSTGLFVLGEEKALE-VAERENIPVYLIVKTESGFVKMSSAFK..... 341
0.000e+00 28  Vibrio vulnificus CMCP6 gi|27365178||ref|NP_760706.1| Thiamin biosynthesis lipoprotein ApbE [Vibrio vuln protmod 21 ...AEQVHLSGPTMGTTYNIKYITQEPKPDVLQQEIDRLLEEVNDQMSTYRKTSELSRFNQSDSAPFAVSQQTATVVKEAIRLNHLTLGALDVTVGPLVNLWGFGPEARRDVVPSAEDLAERKAQTGIEHLSVVDNTLIKTL-PNLYVDLSTIAKGWGVDVVADYIQSQ-GVQNYMVEIGGEIRLKGVNREGVPWRIAIEKPEERAIQDIIEPGDMAIATSGDYRNYFERDGIRYSHIINPKTGMPIHKVVSVTVLDKSSMTADGLATGLMVLGEEKGIEIANQ-NSIPVLMIVKTDDGFTEASDAYKPY... 331
0.000e+00 30  Photorhabdus luminescens subsp. laumondii TTO1 gi|37525170||ref|NP_928514.1| Thiamine biosynthesis lipoprotein ApbE precursor [ protmod 31 ..........GQTMGTYYSIKFVSSAPSPEALQKEIDRLLEEVNGQMSTYRPDSELSRFNRQIDRPFPVSPATAKVVKEAIYINKLTDGALDVTVGPLVNLWGFGPEGHVTKAPSASELEKRREWTGIDKLVVEGNNL-IKTVPELYIDLSSIAKGYGVDVVAEYLESQN-IKDYMVDIGGEVRTSGHNGKDLLWRIAIEKPSDQNAQEVIMPGNMSIATSGDYRNYFEQNGVRYSHTIDPKTGNPIHNLVSITVIAPVCMSADGLSTGLNVLGPEKGMEVAENL-NIPVFMIIKTKNGFEERSKAFEPY... 337
0.000e+00 27  Haemophilus influenzae R2846 gi|46128962||ref|ZP_00154709.2| COG1477: Membrane-associated lipoprotein involve protmod 21 QKETKVISLSGKTMGTTYHVKYLDDGATSEKTHEEIEAILKDVNAKMSTYKKDSELSRFNQNTNTPIEISADFAKVLAEAIRLNKVTEGALDVTVGPVVNLWGFGPEKRPEKQPTPEQLAERQAWVGIDKIALDMSGAKPTLSPQVYVDLSSIAKGFGVDQVAE-KLEQLNAQNYMVEIGGEIRAKGKNIEGKPWQIAIEKPTERAAEAVIGLNNMGMASSGDYRIYFEENGKRFAHEIDPKTGYPIHHLASITVLAPTSMTADGLSTGLFVLGEDKALEVAEK-NNLAVYLIIRTDNGFVTKSSAFK..... 339
0.000e+00 27  Haemophilus influenzae Rd KW20 gi|16272137||ref|NP_438340.1| lipoprotein [Haemophilus influenzae Rd KW20] gi|15 protmod 21 QKETKVISLSGKTMGTTYHVKYLDDGATSEKTHEEIEAILKDVNAKMSTYKKDSELSRFNQNTNTPIEISADFAKVLAEAIRLNKVTEGALDVTVGPVVNLWGFGPEKRPEKQPTPEQLAERQAWVGIDKITLDTNKEKATLSPQVYVDLSSIAKGFGVDQVAE-KLEQLNAQNYMVEIGGEIRAKGKNIEGKPWQIAIEKPTERAVEAVIGLNNMGMASSGDYRIYFEENGKRFAHEIDPKTGYPIHHLASITVLAPTSMTADGLSTGLFVLGEDKALEVAEK-NNLAVYLIIRTDNGFVTKSSAFK..... 339
0.000e+00 29  Vibrio cholerae O1 biovar eltor str. N16961 gi|9656853||gb|AAF95433.1| thiamin biosynthesis lipoprotein ApbE [Vibrio cholera protmod 54 ...AEQVHLSGPTMGTTYNIKYIQQPADSKTLQTEIDRLLEEVNDQMSTYRKDSELSRFNQHTSEPFAVSTQTLTVVKEAIRLNGLTEGALDVTVGPLVNLWGFGPEARPDVVPTDEELNARRAITGIEHLTIEGNTLSKDIPE-LYVDLSTIAKGWGVDVVADY-LQSQGIENYMVEIGGEIRLKGLNRDGVPWRIAIEKPDQRSVQEIIEPGDYAIATSGDYRNYFEQDGVRYSHIIDPTTGRPINNVVSVTVLDKSCMTADGLATGLMVMGEERGMA-VAEANQIPVLMIVKTDDGFEYASSSFKPF... 364
10  0.000e+00 29  Yersinia pestis biovar Medievalis str. 91001 gi|45440549||ref|NP_992088.1| thiamine biosynthesis lipoprotein [Yersinia pestis protmod 43 ...PEQVSLEGKTMGTSYSIKYVSDSSTAETLQQEIDLILEEVNDQMSTYRPHSELSRFNQSRNQPFPVSAATAKVVQEAIRINRLTDGALDVTVGPLVNLWGFGPEGRPDTVPTEDEITRRRAWVGIDKLAVD-KNALIKRVPELYVDLSSIAKGYGVDVVAEY-LEAQNIKDYMVDIGGEVRTRGNNGENKPWRIAIEKPVAGSAQEIIEPGRMAVATSGDYRNYFEQDGIRYSHTIDPDTGRPIHRLVSITVLDPSCMTADGLSTGLGVLGPERGMAL-ANLLGIPVLMIIKTDDGFEEYSDAFKPY... 355
11  0.000e+00 31  Vibrio parahaemolyticus RIMD 2210633 gi|28899119||ref|NP_798724.1| thiamin biosynthesis lipoprotein ApbE [Vibrio para protmod 19 QPADQ-IHLSGPTMGTSYNIKYIEQDPTPKALQTEIDRLLEEVNDQMSTYREDSELSRFNQHTSEPFEVSAQTATVVKEAVRLNGLTLGALDVTVGPLVNLWGFGPEARPDVVPSDEELAARKANTGIHHLTVDGNKLSKDI-PNLYVDLSTIAKGWGVDVVADY-LQSVGIKNYMVEVGGEMRLKGINREGVPWRIAIEKPTVDEIQEIIEPGDMAIATSGDYRNYFESNGVRYSHIINPQTGKPIHHVVSVTVLDKSSMTADGLATGLMVLGEEKGMEI-ANENNIPVFMIVKTEDGFKEASEAYKPF... 331
12  0.000e+00 29  Yersinia pseudotuberculosis IP 32953 gi|51595243||ref|YP_069434.1| thiamine biosynthesis lipoprotein [Yersinia pseudo protmod 23 ...PEQVSLEGKTMGTSYSIKYVSDSSTAETLQQEIDLILEEVNDQMSTYRPHSELSRFNQSRNQPFPVSAATAKVVQEAIRINRLTDGALDVTVGPLVNLWGFGPEGRPDTVPTEDEITRRRAWVGIDKLAVD-KNALIKRVPELYVDLSSIAKGYGVDVVAEY-LEAQNIKDYMVDIGGEVRTRGNNGENKPWRIAIEKPVAGSAQEIIEPGRMAVATSGDYRNYFEQDGIRYSHTIDPDTGRPIHRLVSITVLDPSCMTADGLSTGLGVLGPERGMAL-ANLLGIPVLMIIKTDDGFEEYSDAFKPY... 335
13  0.000e+00 98  Thermotoga maritima MSB8 gi|15644301||ref|NP_229353.1| hypothetical protein TM1553 [Thermotoga maritima M protmod 40 RTKDQYYELRDFALGTSVRIVVSSQKINPRTIAEAILEDMKRITYKFSFTDERSVVKKINDHPNEWVEVDEETYSLIKAACAFAELTDGAFDPTVGRLLELWGFTGNYENLRVPSREEIEEALKHTGYKNVLFDDKNMRVMVKNGVKIDLGGIAKGYALDRARQIALSFDENATGFVEAGGDVRIIGPKFGKYPWVIGVKDPRGDDVIDYIYLKSGAVATSGDYERYFVVDGVRYHHILDPSTGYPARGVWSVTIIAEDATTADALSTAGFVMAGKDWRKVVLDFPNMGAHLLIVLEGGAIERSETFKLFERE 352
14  2.000e-98 30  Idiomarina loihiensis L2TR gi|56460152||ref|YP_155433.1| Thiamine biosynthesis lipoprotein ApbE [Idiomarina protmod 28 ...PEKISFSGKTMGTTYSVTVYSKDPNKEEIQKKVDIVLKRVNAQMSTYDPESELSQFNQKSTQPMVISRDLERVVNRGLEIAEETEGALDITVGPLVNLWGFGPQARPEKEPSEEELNAVREKTGYQKLRVE-NHQLIKDNPELYVDLSTIAKGYGVDRVA-HLLDQLRIKQYLVEIGGEVIAKGGKPDEALWRLAIEKPTERAVQRVVQFKDGALATSGDYRNYYEEDGKRYSHIIDPVTGAPVHNLVSTSVYAEDTMSADAYATALFVMGTEKAKSFAKKH-NMAVMLIYKTDDGFEYMSEAFKP.... 337
15  4.000e-97 27  Shewanella oneidensis MR-1 gi|24372693||ref|NP_716735.1| thiamin biosynthesis lipoprotein ApbE [Shewanella protmod 33 .KQDEVISLAGSTMGTTYHIKVVPNEPTAQLLQAEIDLALEQVNNQMSTYRPNSELSRFNQLPEQSVEVSPDTIKVVREGMRLYDVTDKALDITLGPLVNLWGFGPDKRPTKVPSQAEIDAAKAKTGIRELSIEGNLLRKH-NAHLYVDLSSIAKGFGVDKVASILDKYQA-TGYLVEIGGELSIKGTKGDASSWRVAIEKPTDEGVQQVIEPGTMSMATSGDYRNYYEEAGQRFTHIIDPRTGLPIHKLASVTVLHNECMTADGFATAMMVLGTEASLELAKK-EHLAIMLIEKGEGFKVYYSDAFKPF... 345
16  9.000e-97 27  Haemophilus somnus 129PT gi|23467964||ref|ZP_00123539.1| COG1477: Membrane-associated lipoprotein involve protmod 23 QKEAELVSLNGRTMGTTYHIKYIDEGKTKQKMHEGIEGILQDVNAKMSTYIPNSELSVFNKNKNNPIEISADLAFVVAEAIKLNQITQGALDVTVGPIVNLWGFGPEKRVEKAPTPEQIAERKAWVGIEKVRLTQKDNKFFLTPQIYIDLSSIAKGFGVDKVADYI-AEQGITDYLVEIGGEIRANGHNAENKAWQIAIEKPTFDGVSQVVGLQDLAMATSGDYRNYFEQDGKRFSHEIDPTTCQPVHNLASITVLSKSAMTADGLSTGLFVLGAEKALEIAEQ-NDLPIYLTVKTPQGFEKMSSKF...... 340
17  2.000e-96 27  Haemophilus somnus 2336 gi|53728680||ref|ZP_00131754.2| COG1477: Membrane-associated lipoprotein involve protmod 23 QKEAELVSLNGRTMGTTYHIKYIDNGKTKQKMHEGIEGILQDVNAKMSTYIPNSELSVFNKNKNNPIEISADLAFVVAEAIKLNQITQGALDVTVGPIVNLWGFGPEKRVEKAPTPEQIAERKAWVGIEKVRLTQKDNKFFLTPQIYIDLSSIAKGFGVDKVADYI-AEQGITDYLVEIGGEIRANGHNAENKAWQIAIEKPTFDGVSQVVGLQDLAMATSGDYRNYFEQDGKRFSHEIDPTTCQPVHNLASITVLSKSAMTADGLSTGLFVLGAEKALEIAEQY-DLPIYLTVKTPQGFEKMSSKF...... 340
18  6.000e-96 26  Neisseria meningitidis MC58 gi|7225790||gb|AAF40991.1| thiamine biosynthesis lipoprotein ApbE [Neisseria men protmod 28 EQTAQTVTLQGETMGTTYTVKYLSNNRDPAEIQKRIDDALKEVNRQMSTYQPDSEISRFNQHAGKPLRISSDFAHVTAEAVRLNRLTHGALDVTVGPLVNLWGFGPDKSVTREPSPEQIKQAASYTGIDKIILKQGKDYASLHPKAYLDLSSIAKGFGVDKVAGELEKY-GIQNYLVEIGGELHGKGKNARGEPWRIGIEQPQGGNTQIIVPLNNRSLATSGDYRIFVDKNGKRLSHIINPNNKRPIHNLASISVVADSAMTADGLSTGLFVLGETEALKLAE-REKLAVFLIVRDKGG--YRTAMSSEFEK. 348
19  3.000e-95 26  Neisseria meningitidis Z2491 gi|7379467||emb|CAB84029.1| putative thiamine biosynthesis protein [Neisseria me protmod 28 EQTAQTVTLQGETMGTTYTVKYLSNNRDPAEIQKRIDDALKEVNRQMSTYQPDSEISRFNQHAGKPLRISSDFAHVTAEAVHLNRLTHGALDVTVGPLVNLWGFGPDKSVTREPSPEQIKQAASYTGIDKIILKQGKDYASLHPKAYLDLSSIAKGFGVDKVAGELEKY-GIQNYLVEIGGELHGKGKNARGEPWRIGIEQPQGGNTQIIVPLNNRSLATSGDYRIFVDKSGKRLSHIINPNNKRPIHNLASISVVADSAMTADGLSTGLFVLGETEALKLAE-REKLAVFLIVRDKGG--YRTAMSSEFEK. 348
20  1.000e-94 29  Microbulbifer degradans 2-40 gi|48862041||ref|ZP_00315939.1| COG1477: Membrane-associated lipoprotein involve protmod 2 ......YRLEGKTMGTQYHIKMVVPPPSQSELQYAVDEELRRINDVLSTYIASSELSRLNQSQSDWQPVSENLYFMLELSKEINAQSMGAFDVTVGPLVNLWGFGPDKPLGSNPSDEAIANALTKIGSDKYSLDSTKRAIKKANALYIDLSAIAKGYGSDLIAD-LLRKKGIENFMVEIGGEIRVAGVNEHGEHWKIGVEKPLQSGAIQAIAITDVGLATSGDYRNYYEVDGKRFSHTINPSTGKPIHTLASVTVVAASCAQADALATALNVLGPVEGYALAEKLSLAAYFIIRDGEQFTIKYTPQFQPY... 311
21  6.000e-94 36  Clostridium thermocellum ATCC 27405 gi|48859687||ref|ZP_00313618.1| COG1477: Membrane-associated lipoprotein involve protmod 44 ....DLYETQEFLMGTVVLQKIYHE--NAAEIAKEVNDRIAEIESTMTINKPGGEINLLNDAAGKYVKLGEDTLYVLDKAKQYAEISNGAFDVTIGPLVKAWGVFTD--NPRVPSKNEIDELLKLVNYKDINIDFENSTAMLKEGQIVDLGGIAKGFAADEAVEIY-KEHGVKSALISLGGNIFTLSGKPDGSPWMVGIRNPRGNDYIGIVRVKDKAVVSSGDYERFFEKDGVRYHHILDPKTGYPATGLIGTTIISDFSIDADALSTAVFVLGLEEGMKLVESLD--GVDAVFITADKKIYVTDGLKD.... 346
22  3.000e-93 29  Nitrosomonas europaea ATCC 19718 gi|30250316||ref|NP_842386.1| ApbE family [Nitrosomonas europaea ATCC 19718] gi| protmod 43 ..........GYTMGTKYSVKYRHPEFTPDTAQKQIESVLDEINRAMSTYDPESELSRLNRATSDWIPVSDSLFTVLEAALEIGARSEKAFDITVGPAVNLWGFGPEFHSERIPDKSEIAAVLPAIGQDKLVLDRETHAIKLHSDIYIDLSAIAKGYAVDRVAEIF-DARGIEHYLVEIGGEIRARGTNAQNTPWQIGIEKPHHQAPYKILSLQDTGLATSGDYQNFFEIEGHRYSHLIDPTTGWPVENGASVTVLAESCMVADAWATALLVLGHERGLTIAE--DQGIAVLFIVNQEGVIKYTSSHFPAER. 351
23  6.000e-93 27  Pasteurella multocida subsp. multocida str. Pm70 gi|15603199||ref|NP_246272.1| ApbE [Pasteurella multocida subsp. multocida str. protmod 22 .KSPEVVTITGKTMGTTYSVKYIDDGIKPIEMHGQIEEILKEVNNKMSTYLSTSELSQFNQNTDTPVEISADLAFVLKEAIRLHGVTEGALDVTVGPIVNLWGFGPEKRQPNETLEEQVEKRRAWVGIEKMKLTEQGDKFYLAPQLYIDLSSIAKGFGVDKVAAH-LATKGIANYLVEIGGEINAKGKNIEGKDWQIAIEKPNFDGVSQIIGLKDFSMATSGNYRNYFEENGRRFSHEIDPKTGYPIHRLASITVLADSTMTADGLSTGLYVLGEEKALEVAEKY-NLLVYLISKTEKGFEKMSSAF...... 338
24  7.000e-92 25  Haemophilus ducreyi 35000HP gi|33147834||gb|AAP95355.1| thiamine biosynthesis lipoprotein [Haemophilus ducre protmod 17 .KSAEQITLQGKTMGTTYTVKYIDDGPTAEQVKKQLDDVLKVVNDEMSTYQLDSQISRFNREVNTPFEISPDFATVVAEAIRLNKITEGALDVTVGPLVNLWGFGPDRRLDKQPSAAQINQRAAFVGIDKLALNIEHKPTLTKPNLYLDLSSIAKGFGVDKIAD-QLEMLGLENYLVEVGGELRGKGKNLQGLNWQIAIEKPQGQTVQITVPLHNLGMATSGNYRNYFEDEGNRLSHIIDPKALKPVHKLASITVLAPTSMTADGLSTGLFVLGAEKALE-VAEREKLAIFLIIKNGDGFTQMSSQFK..... 336
25  9.000e-92 31  Listeria monocytogenes EGD-e gi|16804674||ref|NP_466159.1| hypothetical protein lmo2636 [Listeria monocytogen protmod 38 ..MDQPYSKTDFLMGTVVTLKIYDKG--KEDVLDKGFDRIKDLAAKITTSDKTSEVDKINEQAGKPVKVSEDVYYLIQEGLKYSENSGGSFDITIGPLTSLWHIG--FSDARKPSQAEIDAVLPLINYKDVKMNDKDQTVYLKEGMELDLGAIAKGFITDETLKVF-KENKVTTSIIDLGGNIYVQGNNPNGNKWNVGIQDPFSPSVIGKLPESNMSIVTSGIYERYLEVDGKTYHHILDPKTGYPDNDIAGVSIVSKKSIDGDGLSTATFSKGIKGGMDYIEQFE--GVDAIFISKEKKVYETSGLK..... 343
26  2.000e-91 31  Listeria monocytogenes str. 4b F2365 gi|46908808||ref|YP_015197.1| thiamine biosynthesis lipoprotein ApbE, putative [ protmod 38 ..MDQPYSKTDFLMGTVVTLKIYDKG--KEDVLDKGFDRIKDLAAKITTSDKTSEVDKINEQAGKPVKVSKDVYYLIQEGLKYSENSGGSFDITIGPLTSLWHIG--FSDARKPSQAEIDAVLPLINYKDVKMNDKDQTVYLKEGMELDLGAIAKGFITDETLKVF-KENKVTTSIIDLGGNIYVQGNNPNGNKWNVGIQDPFSPSVIGKLPESNMSIVTSGIYERYLEVDGKTYHHILDPKTGYPDNDIAGVSIVSKKSIDGDGLSTATFSKGVKGGMDYIEQFE--GVDAIFISKEKKVYETSGLK..... 343
27  2.000e-91 27  Pseudomonas aeruginosa UCBPP-PA14 gi|46163963||ref|ZP_00204930.1| COG1477: Membrane-associated lipoprotein involve protmod 25 ...DTLESFGGPTMGSTYSIKYVASAPDVQTAKAAVEAILAEVDRQMSTYRDDSLVSRFNALPAQSCELPPPMLELLRYGGELSEQSQGAFDMTVEPLMNLWGFGPQARVEKVPSAEQIAAARRDVGHRHLRIDGQ--RLCKDAAVQLDFDSIAAGYTVDAVGER-LKELGVRSYLAEITGELKAEGRKPDGTPWRIAIEAPREGQAQQVLALDGYGVSTSGDYRNYFEENGQRYSHTFDPRTGAPIHHLASVTVLDPSTRNADGLSTLLMVLGPEEGYRFAEKHR---LAALFVSRQG.............. 320
28  3.000e-91 30  Listeria innocua Clip11262 gi|16801846||ref|NP_472114.1| hypothetical protein lin2785 [Listeria innocua Cli protmod 40 ....QPYSKTDFLMGTVVTLKIYDKG--KEDVLDKGFDRIKDLAAKITTSDATSEVDKINEQAGKPVKVSKDVYYLIQEGLKYSENSGGSFDITIGPLTSLWHIG--FSDARKPSQAEIDAVLPLINYKDVKMNDEDQTVYLKEGMELDLGAIAKGFITDETLKVF-KDNKVTTSIIDLGGNIYVQGKNPNGNKWNVGIQDPFSPSVIGKLPESDMSIVTSGIYERYLEVDGKTYHHILDPKTGYPDNDIAGVSIVSKKSIDGDGLSTATFCKGIKGGMDYIEQFK--GVDAIFISKEKKVYETSGLK..... 343
29  6.000e-91 29  Rubrivivax gelatinosus PM1 gi|47573270||ref|ZP_00243309.1| COG1477: Membrane-associated lipoprotein involve protmod 28 ...AAVQELGGPTMGTRWSVKYWHAPATPREVREAIEIALDLVVRQMSTWEDDSDLSRYNRAAGRWQKLPEPLFSVLQHALELARATGGAYDPTVGPAVNLWGFGPDPARRDAPTEGDLEMARRRIGWQRVQLDVEQRRARQDGGTYVDLSSIAKGYAVDAVAR-ALQRLGCGNALVEVGGELLGMGRRPDGQPWRVAVRLPEQGDAGPVLALKGLAVATSGDDFRCFEDDGERHSHTIDPRTGRPVHALASVTVVHAQCMQADALATALTVLGPDEGWTYAE-RERLAVLFIRRAADGGHEATAGF...... 340
30  7.000e-91 24  Shigella flexneri 2a str. 301 gi|24113599||ref|NP_708109.1| hypothetical protein SF2298 [Shigella flexneri 2a protmod 32 ...TEVTVLEGKTMGTFWRASIPGIDAKSAELKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSSPWPVSEAMADIVTTSLRIGARTDGAMDITVGPLVNLWGFGPEQQPVQIPSQEQIDAMKAKTGLQHLTVINQSHQQYLQPDLYVDLSTVGEGYAADHLAR-LMEQEGISRYLVSVGGALNSRGMNGEGQPWRVAIQKPTDNAVQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIHNLVSVTVIAPTALEADAWDTGLMVLGPEKAKEVV-RREGLAVYMITKGDSFKTWMSPQFKSF... 345
31  7.000e-91 33  Enterococcus faecium gi|48824451||ref|ZP_00285826.1| COG1477: Membrane-associated lipoprotein involve protmod 26 ....DPYSDEQFLLGTYVRIRVYDEG--KESTLKPAFDRVKELGDKITINQKGSEIDEVNEQAGKPVKVSDDVYTLVKRAYEYSQDSQGGFDMAIGAITQLWRIG--FDDARKPSQEEIDQALKLVDYHKIELNDKEKTVYLKKGMIIDLGAIAKGYITDEVVKV-LKKQGVTTAIVDLGGNVYVLGHSPRGQDWTVGIQDPNRGSVLGSIKERNKTLVTSGIYERYLEVDGKKYHHLFDPKTGYPDNDIASVTIITDKSIDGDGLSTAVFSMGVKKGLEYVESELNNGTEAIFVTKDDKVYVTDTFKLSE.. 338
32  7.000e-91 24  Escherichia coli CFT073 gi|26248602||ref|NP_754642.1| Thiamine biosynthesis lipoprotein apbE precursor [ protmod 32 ...TEVTVLEGKTMGTFWRASIPGIDAKSAELKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSSPWPVSEAMADIVTTSLRIGARTDGAMDITVGPLVNLWGFGPEQQPVQIPSQEQIDAMKAKTGLQHLTVINQSHQQYLQPDLYVDLSTVGEGYAADHLAR-LMEQEGISRYLVSVGGALNSRGMNGEGQPWRVAIQKPTDNAVQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIHNLVSVTVIAPTALEADAWDTGLMVLGPEKAKEVV-RREGLAVYMITKGDSFKTWMSPQFKSF... 345
33  1.000e-90 24  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50120784||ref|YP_049951.1| thiamine biosynthesis lipoprotein [Erwinia carotov protmod 28 .AQRPLLTIEGKTMGTFYSVKISGDVTEDKTLQREIDALLEQANNDISTYRDDSVLSRFNQYRGTPQPISNGMADIILAALRIGKATHGAMDITVGPLVNLWGFGPQKQPTRIPSQQQIDLARQNVGLRHLKLIGEKGEWIQKPDLYVDLSTLGEGYGADILAQ-LMTRKGITNYLVSVGGAISSRGINAEGTPWRVAIQKPTDNAAQAAVNLQGYAISTSGSYRNYFEEDSKRYSHVIDPETGRPIHQLVSATVIAPTALEADGWDTGLMVLGTEKALKLAEQ-QGLAVYLITKTDKGFTVMTPQFKSF... 343
34  1.000e-90 25  Salmonella typhimurium LT2 gi|16420805||gb|AAL21168.1| putative thiamine biosynthesis lipoprotein [Salmonel protmod 29 .ASPAAQVLEGKTMGTLWRVSVVGIDAKAAELQTKIQTQLDADDWLLSTYKNDSALMRFNHSRSAPWPVSEAMADIVTSALRIGAKTDGAMDITVGPLVNLWGFGPDRQPLHIPTPAQIDAAKAKTGLQHLQVIDRAGHQFLQPDLYVDLSTVGEGYAADHLAR-LMEQEGIARYLVSVGGALSSRGMNAQGQPWRVAIQKPRENAVQAIVDINGHGISTSGSYRNYYELDGKRVSHVIDPQTGRPIHNLVSVTVIAPTALEADGWDTGLMVLGTQKAQEVV-RREGLAVFMIMKGEGFKTWMSPQFKTF... 344
35  2.000e-90 24  Escherichia coli K12 gi|1788543||gb|AAC75274.1| orf, hypothetical protein; putative thiamine biosynth protmod 32 ...TEVTVLEGKTMGTFWRASIPGIDAKSAELKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSSPWPVSEAMADIVTTSLRIGAKTDGAMDITVGPLVNLWGFGPEQQPVQIPSQEQIDAMKAKTGLQHLTVINQSHQQYLQPDLYVDLSTVGEGYAADHLAR-LMEQEGISRYLVSVGGALNSRGMNGEGLPWRVAIQKPTDNAVQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIHNLVSVTVIAPTALEADAWDTGLMVLGPEKAKEVV-RREGLAVYMITKGDSFKTWMSPQFKSF... 345
36  2.000e-90 28  Ralstonia eutropha JMP134 gi|46131724||ref|ZP_00170100.2| COG1477: Membrane-associated lipoprotein involve protmod 20 QTRAQRW--SGETMGTTWSVVAMLQEADADALEQGICAVLDSVIAQMSNWEADSDVSRFNRAADTWVALPADCVRVLACALQVARDSGGAYDPSAGPLVDLWGFGPAPRRCATPAPDQVAQVRQQCGWDRIELDIDGGCALQPGGVSLDFCAIAKGFAVDAVAQY-LESEGVAHHLTEIGGELRGHGVKPDGLPWWVQLETPPDCAVQTLVAMYGLSVATSGDYRRFFDSEGRRYAHTIDPRTGYPAHALASVTVLHTECMMADALSTALTVLGPQAGMEHARRH-GIAARFLVRTPGGFEHLSPAF...... 330
37  3.000e-90 25  Salmonella enterica subsp. enterica serovar Typhi Ty2 gi|29141112||ref|NP_804454.1| thiamine biosynthesis protein [Salmonella enterica protmod 29 .ASPAAQVLEGKTMGTLWRVSVVGIDAKAAELQTKIQTQLDADDWLLSTYKNDSALMRFNHSRSAPWPVSEAMADIVTSALRIGAKTDGAMDITVGPLVNLWGFGPDRQPLHIPTPAQIDAAKAKTGLQHLQVIDRAGHQFLQPDLYVDLSTVGEGYAADHLAR-LMEQEGIARYLVSVGGALSSRGMNAQGLPWRVAIQKPRENAVQAIVDINGHGISTSGSYRNYYELDGKRVSHVIDPQTGRPIHNLVSVTVIAPTALEADGWDTGLMVLGTQKAQEVV-RREGLAVFMIMKGEGFKTWMSPQFKTF... 344
38  3.000e-90 25  Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150 gi|56412836||ref|YP_149911.1| thiamine biosynthesis protein [Salmonella enterica protmod 29 .ASPAAQVLEGKTMGTLWRVSVIGIDAKAAELQTKIQTQLDADDWLLSTYKNDSALMRFNHSRSAPWPVSEAMADIVTSALRIGAKTDGAMDITVGPLVNLWGFGPDRQPLHIPTPAQIDAAKAKTGLQHLQVIDRAGHQFLQPDLYVDLSTVGEGYAADHLAR-LMEQEGIARYLVSVGGALSSRGMNAQGLPWRVAIQKPRENAVQAIVDINGHGISTSGSYRNYYELDGKRVSHVIDPQTGRPIHNLVSVTVIAPTALEADGWDTGLMVLGTQKAQEVV-RREGLAVFMIMKGEGFKTWMSPQFKTF... 344
39  1.000e-89 34  Clostridium tetani E88 gi|28210732||ref|NP_781676.1| thiamine biosynthesis lipoprotein apbE precursor [ protmod 23 .KEEKVITKENYLLDTLIQLKAYGK--NSEKATNEAMDAISDIDDIMSPTKPTSDVVKINNNAGKFVKINENTLEVIKTSIKYSKLSKGNFDITVGPLVKLWGIGTE--NARVPSKEEIDTTLKLINYENVLIDEKNKSIKLKPKEAIDLGGIAKGFAGDKAREI-LENKGIKSAYLNLGGNIVTIGNKTDGTPWNIGIQDPLSDEYFGIVRVSNKSVVSSGNYERFFIKDNKRYHHILNTKTGYPSEGILSSTIISDKSIDGDALSTITFILGLEKSMEIIENID--GVDAIFVTTDKKVHTTSNFKLSSKE 336
40  2.000e-89 28  Silicibacter pomeroyi DSS-3 gi|56708826||ref|YP_164867.1| thiamin biosynthesis lipoprotein ApbE [Silicibacte protmod 38 EAEPEVVKLSGDTMGTTYHITAIGADLDAEALGAAVEVTLAAVNAKMSNWDPKSEVSTFARTDTAPMPVSPEFVTVIGAANQVHAQSGGKFDITLGPLIELWGFGPRKPEDPIPSDAEIASALQGVGQARLTLDTAGGTLAKRPETGINLSAIAKGYGVDAVAETLRGFE-IDDYMVEIGGDLVTRGKNDKGEAWRIGIERPDRGAVQLVVPISDYGMATSGDYRNYFEHQGQRYSHILDPVTGRPVHRTTSVTVIADSAMMADAWATAMLVLGLDQGLKVAEAHK-LAVFFIERDDGAEAYMTAQSSAF... 353
41  5.000e-89 25  Pseudomonas fluorescens PfO-1 gi|48730021||ref|ZP_00263770.1| COG1477: Membrane-associated lipoprotein involve protmod 14 ...DSLETFGGPTMGSTYSIKYHAHLPAPQTVRIEVEKILADVDRQMSTYRADSDISRFNALPADRCQVPAPILELIRVGEQLSQQSEGSYDLTVEPLMNLWGFGPQGREEKVPDAAALAKVRQRVGHQHLHIDGD--RLCKDAAVEVDVNSIAAGYAVDTITAR-LEALGIHDYLAEATGELKASGKKLDGSPWRIALEEPQDDQQVAVINVDGYGLSTSGDYRNYFQQDGRRYSHTFDARTGAPVHDLASVTVIHPSALMADGLSTLLLILGPERAWDYAEKH-DIGAFFVIRADTGFVTRTS--HAFER. 322
42  6.000e-89 26  Actinobacillus pleuropneumoniae serovar 1 str. 4074 gi|53728868||ref|ZP_00134693.2| COG1477: Membrane-associated lipoprotein involve protmod 1 .............MGTTYTVKYIDNGEKPEEVQKTLDDLLKQVNNEMSTYQPDSQISRFNQEVNKAVQISPDFAKVVREAIRLNRVTEGALDVTVGKLVNLWGFGPDKRLNKAPSAEQIAALAPSVGIEKLSVSDNSLMKSV-PNLYLDLSSIAKGFGVDKLAEH-LESLGLANYLVEIGGELRGKGKNLQGVDWRIAIEQPQGQAAQITVPLHNLGMATSGNYRNYFEDEGNRLSHIINPKELRPVHKLASITVFAPTTMTADGLSTGLFVLGPEKALE-VAEREKLAVFLII--KNGEAFETKMSREFEK. 306
43  1.000e-88 29  Ralstonia metallidurans CH34 gi|48772137||ref|ZP_00276479.1| COG1477: Membrane-associated lipoprotein involve protmod 18 EPQGSIAQWTGETMGTTWAVRAVLARGQDGGGLEAIRAVLDEVIAQMSNWSEISDLSRFNRAASAWVTLPEDCFTVLQAALDTARDSGGAYDPSAGPLVDLWGFGPAGKRHTAPTADDVARARQHCGWQRIEIDPSARRARQPGGLSLDFCAIAKGFAVDAVSRYLL-AQGVPHHLVEIGGELRGQGLKPDGMPWWIELESPSASATAALVALLGLSIATSGDYRRYFEHDGRRYAHTIDPRTGYPAHALASVTVLHRECMMADALSTALTVLGPEAGITF-ATRQGLAARFLVRTPHGFDERTPAF...... 332
44  3.000e-88 28  Desulfitobacterium hafniense DCB-2 gi|23111444||ref|ZP_00097093.1| COG1477: Membrane-associated lipoprotein involve protmod 5 ....EPVVETTFLMGTVAKITIYDE-IKDNEIFQRVFDRLTDIEQRMTINDPNSEIIQLNKASGKFVKINPDTFYVLEKAKYLAELSQGKFDITVGPIVKLWNIGSD--NARVPGIDEINKKLPLVDYHNLILDKDNSSAKLNEGMVVDLGAIAKGYAADEAVKI-LKEAGIEHAIVNLGGNIVAMNTKLDGSLWRLGLQDPYEGKSMGVVLLNDQTMVSSGTYERYFEEGGKVYHHLIDPDTGYPGENLISVSIITKESINADGLSTGTFLLGLEEGMKMIEKIPDT--EAIFITADKKVYVTSGINSSNFE 314
45  5.000e-88 33  Methanosarcina acetivorans C2A gi|20089544||ref|NP_615619.1| membrane protein [Methanosarcina acetivorans C2A] protmod 34 ....QEFQQTKNIMDTTVTVAVYAPESEASKATDDAFSEIYRIDALMSPSKEDSQLTILNT-VGEVENADPDFIYVLEQSKYYSEKSGGAFDITIQPVLDLWKFLPGGSQE-PPTADELNETLKLVNYSKISI--ENGTVSLEPGMKIALGGIAKGYAVDKAIE-ALEEDGIENAFVNAGGDGKYIGQKSDGTPWVVGLQNPRSGQYVTAIEARDIAVATSGNYERYFNESAK-VSHISDPRTGYPSEGIISSTVIAGNAIDADSFATAIFVLGEEEGLEMIENLE--GVECLIITEDRRLVYSSGFKEYETE 338
46  2.000e-87 30  Silicibacter sp. TM1040 gi|52010086||ref|ZP_00337447.1| COG1477: Membrane-associated lipoprotein involve protmod 16 .....LLELSGLTMGTSYSIVAHSKSVEKAELQAAVDKALAQVNVQMSNWDAASEVSQFNAAAGESLSVSGELHHVMQAAQDVHFASDGAFDVTVGGLIDLWGFGAGQTRSDLPSEAEIAAAMGCCGQAQSVELEAGGLKKLNAGAEVYLSSIGKGFGVDQLARV-LKGYGITDYMVEIGGDLYTAGRNPDGQPWQIGIETPFDRGVTQVVGLSDMGMATSGDYRNFFDVDGKRYSHIIDATTGRPVHDTASVTVLTDNAMLADAWATAMLVLGRERGLEIANQR-DLAVLFL.................... 307
47  4.000e-87 25  Azotobacter vinelandii gi|23103200||ref|ZP_00089687.1| COG1477: Membrane-associated lipoprotein involve protmod 26 ....QVESFVGPTMGSTYSVKYVQRRPAKEELQRETEAILADLDRQVSTYRSDSDIERFNTLPGSCAAVPDEVRTLVAAGERLSVESEGALDLTVGPLLDLWGFGPHGHGEQVPDAEAIAAARQRVGHQYLRIDGE--RLCKDAPVQVDFNSIAAGHAVDRVAARF-EALGVDSYLVEITGELKARGHKPDGTPWRIAIEAPHDNEAQRIIALDGYAVSTSGDYRNFFEQNGKRYSHTVDPRLGAPVHRLAAVTVVDPSALRADGLSTVLMVLGEERGLAFAEQR---GIAAFLVIRDGQAFVTKSTATFDR. 333
48  1.000e-86 27  Pseudomonas aeruginosa PAO1 gi|9949093||gb|AAG06381.1| conserved hypothetical protein [Pseudomonas aeruginos protmod 25 ...DTLESFGGPTMGSTYSIKYVASAPDVQTAKAAVEAILAEVDRQMSTYRDDSLVSRFNALPAQSCELPLPMLELLRYGGELSEQSQGAFDMTVEPLMNLWGFGPQARVEKVPSAEQIAAVRRDVGHRHLRIDGQ--RLCKDAAVQLDFDSIAAGYTVDAVGER-LKELGVRSYLAEITGELKAEGRKPDGTPWRIAIEAPREGQAQQVLALDGYGVSTSGDYRNYFEENGQRYSHTFDPRTGAPIHHLASVTVIDPSTRNADGLSTLLMVLGPEEGYRFAEKHR---LAALFVSRQG.............. 320
49  1.000e-86 29  Clostridium perfringens str. 13 gi|18145892||dbj|BAB81933.1| thiamin biosynthesis lipoprotein [Clostridium perfr protmod 25 ..KKEPISKSSFFMGTIVNITLYDK--FDEGIIDKAFNKISEIESLLSLNIQNSEINKINEKSGEPVKVTKTTFDIIEKSLEYSKASKGNFDITIGPLVKLWGIGSE--DARVPDDNEILDTIKLINYENIILDKENTTVFLKENMVLDLGAIAKGYIADLISDILID-EGVSKAIIDLGGNIFALGEKNKNENWTIGIQNPFENAPLGTLSICNKSVVTSGIYERYLEINNTKYHHILNPKTGYPDNNLASVTIVSSKSIDGDALSTSTFGMGLSDGLELIESLP--EIEGIFVTKSKEIFISKGLK..... 328
50  2.000e-86 27  Methylobacillus flagellatus KT gi|45521426||ref|ZP_00172946.1| COG1477: Membrane-associated lipoprotein involve protmod 25 ........LRGETMGTTWSVRYVDTAKLAETVAAAVSTALDQVVQQMSTWLQDSVISQFNHAAGTIVKVPPEFAIVLTNALAVAAKTDGCFDPAIGILVDLWGFGPRQVQVLPPAQVSIDEALRESGWKKLEFDPVRRELKQGGKLALDFSGIAKGFGVDQVARV-LRAHGVQHYLVEVGGEFYGQGIKPDGQPWWVALERTPEAARLDVVAVHGLGLATSGDYRRYFEHHGRRYAHTIDPQTGWPVQAPVSVSVLSASCMEADAYATALTVMGLERGLAYAQTH-DIAALFTVETPAGEQHASPRLRE.... 329
51  9.000e-86 30  Enterococcus faecalis V583 gi|29377698||ref|NP_816852.1| thiamin biosynthesis lipoprotein ApbE, putative [E protmod 31 ...TEPYSDRQTMLGTYVQIRIYDDG--KEDVLPKAFARVKELGDKITVNQPGSEIDEINQEAGKPVKVSDDLYPLLKKAYEYSKDSRGGFDMAIGPITSMWHIG--FDDARKPSQAEIDQALKLVDYTKVKFNDKEQTVYLEKGMQLDLGAIAKGFITDEVVKV-LKDNGVTTAIVDLGGNVYVLGHSPRGKDWTVGIQDPNRNTVLGQVKESNKTLVTSGIYERYLKVDGKTYHHLFDRETGYPDNDIAGVTIITDKSIDGDGLSTAVFSMGVKKGLEYVESLK--GTDAIFVTKDDKVYIS......... 331
52  3.000e-85 33  Clostridium acetobutylicum ATCC 824 gi|15896021||ref|NP_349370.1| Thiamine biosynthesis lipoprotein ApbE [Clostridiu protmod 11 ...........FCMGTIISQKIYGE--DKKEVLFKVENEMRRLEKAMNFYSSSSEISKLNKFGFEEIKLSKDVYHVIKNAKNFSKKTLGAFDISLAPIIKLWGI--FCENERVPSVKEIEKNLSLVNYKNLVLNDYKRTVFLVEDMKVDLGGIAKGYAADRAIDIY-KGGGVKSASINLGGNVSVIGEKPDGKSWCIGVQNPKRGEIIGAISVKNKSVVTSGSYVRYFEKDNIKYHHIIDPKTGYPAEELLSVTVIFENSMLCDAVSTAAFIAGADGGIELVKRFRD--VEAIFITKDRKVIITKG....... 303
53  3.000e-85 29  Methylococcus capsulatus str. Bath gi|53756364||gb|AAU90655.1| thiamin biosynthesis lipoprotein ApbE [Methylococcus protmod 22 QTGEDETLLSGDVQGTTYHIKLDGLPADQTELKQAVDAVYDDIDLKLSNYREDSEISRINRAATTWLTVSPEIAELVDIARQVHDKTDGCYDLTVKPLFDLWGFSRH--QTRVPTDAEIAAVLPHIGMDKLEVDVPGRRLRKKPALRIDLSSIAQGYTVGRVAG-LLEAKGIQNYLVEVGGEMQVKGRKANGKPWRVAVEKPTTREVERILDVHGTAIMTSGTYRNFFEEGGKTYSHILDPRTGRPVHHLLSTTVLHPDPTWADAWSTALLCLGEQKGYAIAERERLKA--LLIYGENGKERFTPAF...... 335
54  4.000e-85 26  Salmonella typhimurium gi|1906609||gb|AAB50407.1| unknown [Salmonella typhimurium] protmod 29 .ASPAAQVLEGKTMGTLWRVSVVGIDAKAAELQTKIQTQLDADDWLLSTYKNDSALMRFNHSRSAPWPVSEAMADIVTSALRIGAKTDGAMDITVGPLVNLWGFGPDRQPLHIPTPAQIDAAKAKTGLQHLQVIDRAGHQFLQPDLYVDLSTVGEGYAADHLAR-LMEQEGIARYLVSVGGALNSRGMNAQGQPWRVAIQKPRENAVQAIVDINGHGISTSGSYRNYYELDGKRVSHVIDPQTGRPIHNLVSVTVIAPTALEADGWDTGLMVLGTQKAQEVVRR............................. 318
55  1.000e-84 31  Clostridium acetobutylicum ATCC 824 gi|15896017||ref|NP_349366.1| Thiamine biosynthesis lipoprotein ApbE [Clostridiu protmod 17 ...........YCLGTVINLTAYGK--NAETAIDESIKVLEKIDDKFSAFKTLSEVSKINRTANNFIKLSSEAFSLIENSIYYSRLTNGCFDPTIKPLVNLWNIG--KENFRIPKESEISTSISLVNYTDIVLDKKNSSIMLKKQKQVDLGGIAKGYAADKVKEVFTNYK-VKHGIIDLGGNIFVVGKKDRSHNWNIGIQNPFSGGYIGILNLKNKSVVTSGNYERYSIYKGKKYHHIINPKTGYPEDNVLSVSVISDESIDGDGLSTGLYIMGVKKGIDLVNSIK--GVDCIFVTKKKEVYLTSNFKISNKE 320
56  1.000e-84 28  Bacteroides thetaiotaomicron VPI-5482 gi|29349968||ref|NP_813471.1| thiamine biosynthesis lipoprotein apbE precursor [ protmod 27 ..KAEFNTASGFVFGTVYKIAYQHD----ADLKPEIEAELKRFDQSLSPFNDSSVISRVNR--NEELVTDSFFQTCFNRSMEISRETKGAFDITIAPLANAWGFG--FKKGAFPDSLMIDSLLQITGYEKVKLE-NGKVVKQDPRVMLSCSAVAKGYSVDVIAR-LLDRKGIKNYMVDIGGEVVVKGKNATGDLWRIGINKPYDDDIQVVLNLTDLGMATSGNYRNYYYKDGKKYAHTIDPRTGYPVHSILSSTVIAEDCMTADALATSFMVMELEEAEKFCKANPMIDAYFIYSGENGKTYYTDGMKRY... 333
57  2.000e-84 26  Bacteroides fragilis YCH46 gi|53712474||ref|YP_098466.1| thiamine biosynthesis lipoprotein ApbE precursor [ protmod 28 .KQIPYNSINGLVFGTVYNITYQYDG----NLKAEIDAELKKFDGSLSPFNDTSVITRVNR--NEEIVTDTFFQTCFNRSMEISAETRGAFDITVAPLANAWGFG--FKKGAFPDSIMIDSLLQITGYQKVKLE-NGKVIKEDPRVMLSCSAVAKGYSVDVVARY-LDSKGIKNYMVDIGGELVVKGVNPKEEAWRIGINKPVDDEIQTTLKLTNVGIATSGNYRNFYYKDGKKYAHTIDPRTGYPVHNILSATVVADDCMTADALATAFMVMGLDEAEAFTKSHPNIGAYFIYSDEKGEVYFTKNMKQY... 335
58  2.000e-84 29  Streptococcus suis 89/1591 gi|50590933||ref|ZP_00332271.1| COG1477: Membrane-associated lipoprotein involve protmod 40 .....PLTRSESLLHTVVQLSIYHE--NQEEAMDEAVSYIKEMESLLSTNLEGADVYRINQAAGKAVKVDERTFEVIETAIDMSKESQGLFDISIGAVSNLWKIGDE--DARKPSDEEIKAALPFINYKDITLDKEKKTVFIKEGMTLELGAISKGYIADKVRE-LFASKGITTAIINLGGNVVVMGDSPTTQNWNVGVQDPDQGSTVGSVPGTHDSVVTSGIYERYLEVDGVKYHHILDPKTGYPVENDISVTVFSKTSIQGDALSTTLFLLGVEKGLDFINQID--GVEAVFIDKEQGVHLSDGLKES... 342
59  2.000e-84 35  Symbiobacterium thermophilum IAM 14863 gi|51892040||ref|YP_074731.1| membrane-associated lipoprotein involved in thiami protmod 18 ..RTERVERTAIMMDTSVRVVVYAGGWDAESAADAAMDSIARLESLWHPGRADSDVSRINAAAGKPVVVAPETVELVQAALQVARESRGAFDPTIGPLAAAWGFG---EGGRVPDAAELEAARALVSWRDVHVDPEAGTVFLRPGMQLELGAVAKGFAA-RLVRDQLAQAGVRAALVQLGGSIALLGDRPEGGPWRIAVQHPRDPQYIATLSLDGGYADTAGDYQRYFEADGVRYHHILDPSTGYPARGMASVTVVAPRGELADAYATAAFVLGMEGGYRFLVER---GVEGLLVSDAGEVRMTPGM...... 318
60  2.000e-84 30  Caulobacter crescentus CB15 gi|16127292||ref|NP_421856.1| thiamine biosynthesis protein ApbE, putative [Caul protmod 33 ........FGGETMGTTWSVKAVLPATTDLAALKAVERALDAVVSQMSPWAPLSDLSRYNRAAGSWTVLPPDTLTVLRRALDVAAQTDGAFDPTLGALTDLWGFGPRPFAGQPPQAETLAPRREACGWKRLVLDGEA--LFQPGGLKLDLNGIAKGFGVDQAAAVLDRA-GVRSYLIEVGGELRGIGAKPDGQPWWVELERPAANDTQTLVALHDLAVATSGDYRRFFDHGGRRYAHTLDPATGAPVHATVSVTVLAKDCISADAWATALTVMPPER.................................... 307
61  3.000e-84 28  Lactobacillus plantarum WCFS1 gi|28377866||ref|NP_784758.1| thiamin biosynthesis lipoprotein ApbE [Lactobacill protmod 45 .....PIEDTQFMMGTVVTLRIYNKGKD--NVLAGAFKLLKTEAKEITVNQKGSEIDKINAAAGKPVAVSKDIYPMIKAAYYYSKNSDESFDLAIGPITSLWHIG--FSDAKVPTQQEIDKNVKLVDYKKVKLNDKKRTVYLEKGMQLDLGGIAKGYMTDQVKTYLL-NHGVSTAIIDLGGNIYVLGDSPKGTKWTVGIQDPKAGTAIGSLPAKNKSIVTSGIYERYLKKNGKVYSHLMDPQTGAPYQNLMGVSIISKKSVDGDALSTATFDKGLKGGMKYINGKADQGIGAIFITKDKKVYVSNNLK..... 350
62  6.000e-84 26  Pseudomonas putida KT2440 gi|26988874||ref|NP_744299.1| thiamine biosynthesis lipoprotein, putative [Pseud protmod 19 ...PTLERLGGPTMGSSYSIQYVREPPLPAQVQMAVETILHDIDHHYSTYRGDSIVSQFNRLAGQCLALPPDMLALVSLGQHLAEQSDGAFDLTVEPLLDLWGFGPQARHEQVPEPQALAQVRQRVGYQHLRV--KGRALCKDAPVQLDFNSIVAGHAVDLIAAR-LQAMGVSSFVAEATGELKAVGRKPDGSPWRIALELPREDRQIAIIPVNSLSVSTSGDYRHYFEQNGRRYSHTFDARLGRPVHDLAAVTVLDASALLADGYSTLLLILGPQRGWDFAVAH-DLAAVLVTRAEGGFVRATPAF...... 325
63  9.000e-84 30  Rhodopirellula baltica SH 1 gi|32471620||ref|NP_864613.1| thiamine biosynthesis lipoprotein apbE [Rhodopirel protmod 129 ...ADPLTFRGATMGTTYMVKVHSPPEQPEWASEAIDRELRLVNDQMSTYLKSSELSQFNASSTDWFDVSADTARVVAAALQLSEKTDGAFDVTVGPLVDRWSFGAGERKNDVPSESELDELKKSVGYQHLELDPPALKKDI-ANLRVDLSSIAKGHGVDRIVD-LLAGRDAENVFVEIGGEVRVTGDK-SGKSWKVGIQRPDAQELMVAHKIRDAAMATSGDYRNFFEVDQQRYSHTIDPRTGRPVNGLASVSVITDSCMLADGWATALNVVGREEAMRLASE............................. 415
64  2.000e-82 26  Xylella fastidiosa Ann-1 gi|22996240||ref|ZP_00040504.1| COG1477: Membrane-associated lipoprotein involve protmod 7 ....DLATLGGYTMGTTWSVKLAAPRLDLHPLHNAIQARLDQIVAEMSTWEPNSHISRFNRAPVRWHALPNDFDLVLRTALDIAMTSNGAFDPTVGPLVRLWGFGAYSGNHQIPTPEAITLATTRVGWQHLE-RTTDGHWLQPGGTELDLSAIAKGYGVDAVAAT-LHAKGVEHALVDIGGELYGYGHKPDGTPWRVLVEHQYGNALPPILQLDGLAVATSGDRWHHFEHEGQRYTHTIDPHQGTPIPDPALVTMIASSAMHADAWATALNALGREAGLAL-ANTLGLAVRYLEHNNDAFTYYSPAFT..... 317
65  1.000e-81 30  Xanthomonas axonopodis pv. citri str. 306 gi|21109253||gb|AAM37792.1| thiamine biosynthesis lipoprotein ApbE precursor [Xa protmod 1 .............MGTTWSVKLVAPRRDLHPLHACIQAALDRVVAQMSTWKADSDISRYNRAAGSWHHLPDEFHAVLSAALEFAQASEGAFDPTVGPMVELWGFGASGTRQRVPEAQAIALASLRCGWQRLQLDGR--RVLQPGAAALDLSGIAKGFGVDCVHRALLQS-GIDSALIEVGGELFGYGRKPDASAWRVLVEAPDEDAPPRVLALDGLAVATSGDRWHRFDADGTRYTHTLDPRTGAPVHAPAAVTVLAPDAMQADAWATAMTVLGADAGLAHARKAE-LAVRFLARKDG--ILLESMSPAFER. 301
66  1.000e-81 31  Treponema pallidum subsp. pallidum str. Nichols gi|15639783||ref|NP_219233.1| hypothetical protein TP0796 [Treponema pallidum su protmod 26 RARVREYSRAELVIGTLCRVRVYSKRPAAEAALEEVFTLLQQQEMVLSANRDDSALAALNAQAGSPVVVDRSLYALLERALFFAEKSGGAFNPALGAXVKLWNIG--FDRAAVPDPDALKEALTRCDFRQVHLRGAPHTVQLQAGMQLDLGAIAKGFLADKIVQ-LLTAHALDSALVDLGGNIFALGLKYGDVEWNVGIRDPTGQKPALVVSVRDCSVVTSGAYERFFERDGVRYHHIIDPVTGFPAHDVDSVSIFAPRSTDADALATACFVLGYEKSCALLREFP--GVDALFIFPDKRVRASAG....... 346
67  1.000e-81 32  Methanococcoides burtonii DSM 6242 gi|41719035||ref|ZP_00147968.1| COG1477: Membrane-associated lipoprotein involve protmod 1 .............MDTTVTAAIYDSDTDAVQTVGKAFGRVAQTDELMSSYKNDSQLNMLNEN-NRLENASEELLFVIGRSIYYSNISNGAFDITIKPILDLWKFSPGGT-YRPPSQEEIDTTLELVDCKKIVIEGN--TISTEPGMKVVLGGIAKGYAVDQAIE-SLIDNGIESCFVDAGGDGRYIGTKPDGIKWTVGLQNPKQGEIITVMRLENMAVATSGNYERYFS-DAAKVSHISDPRTGYLSRELISATVIAETTMDADALATTVFVLGEKEGTELIESLE--GIECLIITSDKRILRSSGFTAYE.. 294
68  2.000e-81 29  Melittangium lichenicola gi|38174842||emb|CAD89765.1| hypothetical protein [Melittangium lichenicola] protmod 22 .SSPPVRTETRPMMGTYVTVTLVGTRGEAREGFAAAFSAFSRVNEVMNEWRPDSALSAVNRQAGDFVTVPEDLCAALRRGVLGAKQTEGLFDPTWAALRGLWRFGTDLSP-TLPDPDELKQRCALISSRDVEFAPAPKAGLKRAGMQLGLGGLAKGWAVDRAVE-KLRALGFKHFFVQAGGDFYAAGSKA-GRPWKVGIRDPRGDSVLAVLEVSNAAFSTSGDYENFFLLDGKRYHHIIDPRTCYPATASRSATLLAPSAVDAEVLTKAVFIRGGREGLALAEKH---GAAAVLVTADGQLLASPSL...... 333
69  3.000e-81 28  Bordetella bronchiseptica RB50 gi|33602258||ref|NP_889818.1| thiamine biosynthesis protein [Bordetella bronchis protmod 23 RLSGEPVALAGATMGTTWSARLAPPGVTRQQAQAAIAAALDEVVAQMSTWEAGSDISRFNRAATGWQALPEALFHVLSHALDLADASGGAYDPTIGALVDAWGFGAGPRVHEPPAAAAIAAALADCGHARVRLDAQARSAWQPGGVRLDLSSIAKGYGVDRAA-LALRALGVTACLVEVGGELRAHGARPDGLPWRVAVEVPDASGAHAAVPLRDQSIATSGDYRRYIEQAGRRYAHTLDPRTGKPLNDLASVTVIHPECMLADGLATALGVLGAAAGADYAARH-DLAALFILRGAAGEVRATPAF...... 331
70  5.000e-81 25  Streptococcus thermophilus CNRZ1066 gi|55822714||ref|YP_141155.1| lipoprotein involved thiamine biosynthesis [Strept protmod 4 ....QLTNRRVHLMGTVIDVSIYHKQP--EPLLDQVEALLNLYNKRFSANDDSSELMKINKAAGHPVKIHPELFELISLGKWHSCQPGSHLNIAIGPLIQTWRIG--FSDARLPFPEEITLLLDIINPNAIVLSEENQSVFLQKGMKIDLGALAKGYIADRIADY-LKAENVTSALINLGGNILTFGHNPD-QKWRIGIQNPKENTNLLVLAIRDQSVVTSGIYERTFEIDGKTYHHIFDSQTGYPVSDLASLTIISSLSVDGEIWTTRLFGPSLERIFQEVSSQPN--LEAIIVDKDNHCFQTAG....... 305
71  7.000e-81 26  Xylella fastidiosa Dixon gi|22995239||ref|ZP_00039719.1| COG1477: Membrane-associated lipoprotein involve protmod 7 ....DLATLGGYTMGTTWSVKLAAPRLDLHPLHNAIQARLDQIVAEMSTWESNSHISRFNRAPVRWHALPNDFDLVLRTALDIAMTSNGAFDPTVGPLVRLWGFGAYSGNHQIPTPEAITLATTRVGWQHLE-RTTDGHWLQPGGTELDLSAIAKGYGVDAVAAI-LHAKDVEHALVDIGGELYGYGHKPDGTPWSVLVEHQDDNALPPIIQLDGLAVATSGDRWHHFEHEGQRYTHTIDPHQGTPIPDPALVTMIASSAMHADAWATALNALGREAGLAL-ANTLGLAVRYLEHNNDAFTYYSPAFT..... 317
72  4.000e-80 30  Microbulbifer degradans 2-40 gi|48862669||ref|ZP_00316564.1| COG1477: Membrane-associated lipoprotein involve protmod 19 ....QLYTHTFKAMASPCTLKFYCNDIAAQKIFLAVEEKTRLFEKRYSRYLPFSIVSKINNANGEAIKVDEETAKLLNFATVAWKISGGLFDITSGAFRTVW----DFKNGTVPTSKQIKNVLALVGWEKVKWDGE--TLQMPAGMQIDFGGIVKEYATD-AARTLAESMGVEHGLVELGGDISVIGPHLDGSPWKIALQHPDHKDIDVVVEIGRGCVASSGDYERYFEQDGKRYCHIINPLNGQCAQGVAGVSVIAPHCVMAGTITTTALLKGPQFALDYLAETGLHHQLYLRDYTGEAVLAS......... 312
73  5.000e-80 34  Clostridium perfringens str. 13 gi|18145771||dbj|BAB81812.1| probable thiamine biosynthesis lipoprotein [Clostri protmod 38 ......YEKTEKILGTVVSGVAYGD--NAKEALEKAFNRAKDIENMMSVNIENSELSKVNSEAHKNVKLSDDLYYVIEKSIYYANLTDGALDPTIGHVIDSWGIGTEHAN--IPEKTLIDKYKDLKNYKNIELNPHTKEIFLNENIKLDLGAIGKGYAGDEMRKV-LREEGINSALLNLGGNVVALGNKINNENWSIGIRNPKENKISASVKINDEVVVTSGNYERYFIKDGVRYHHILDPSTAYPAEGLISSTIITKNGIDADALSTATYILGAEKAKKLIEGLD--GVEALFIKDNDFIETSN........ 334
74  6.000e-80 28  Bordetella pertussis Tohama I gi|33592339||ref|NP_879983.1| thiamine biosynthesis lipoprotein precursor [Borde protmod 23 RLSGEPVALAGASMGTTWSARLAPPGVTRQQAQAAIAAALDEVVAQMSTWEAGSDISRFNRAATGWQALPEALFHVLSHALDLADASGGAYDPTIGALVDAWGFGAGPRVHEPPAAAAIAAALADCGHGRVRLDAQARRAWQPGGVRLDLSSIAKGYGVDRAA-LALRALGVTACLVEVGGELRAHGVRPDGLPWRVAVEVPDASGAHAAVPLRDQSIATSGDYRRYIEQAGRRYAHTLAPRTGKPLNDLASVTVIHPECMLADGLATALGVLGAAAGADYAARH-DLAALFILRGAAGEVRATPAF...... 331
75  6.000e-80 26  Oenococcus oeni PSU-1 gi|48865548||ref|ZP_00319407.1| COG1477: Membrane-associated lipoprotein involve protmod 34 QYADVPYQKNEFLMGTICTLTIYYKGKSA--VLNKGMATIRHFDKEATLTEKGSVLDKINANAGKPVKVPDDFWPLIEKAMYFSKNSDGSFDMAIGAVTNLWKIG--LPGARVPSDSEIKSALPLLNYHDVILNKKKHTLYLRKGMRLDFGGIAKGYIADQVKKTFLKNH-VTSAIVSLGGNIYVIGKSHGTRDWNVGIQNPNQGSSVGYVRESDMSIVTAGTYEQYLISHGHKYIYLMNPKTGYPENNLVSVTIISKKSVDGDALSNAAFDKGLKKGLKYMNKKNKQNIQAIFITKDKKIYITNGLK..... 344
76  1.000e-79 26  Xylella fastidiosa 9a5c gi|15837196||ref|NP_297884.1| thiamine biosynthesis lipoprotein ApbE precursor [ protmod 1 .............MGTTWSVKLAAPRLDLHPLHTAIQARLDQIVAEMSTWEPNSHISRFNRAAGSWHALPNDFDLVLRTALDIAMTSNGAFDPTVGPLVRLWGFGAHDGNHQIPTPEAITLATTRVGWQHLE-RTTDGHWLQPGGTELDLSAIAKGYGVDAVAAT-LHAKGVEHALVDIGGELYGYGHKPDGTPWSVLVEHQDDNALPPILQLDGLAVATSGDRWHHFEHEGQRYTHTIDPHQGTPIPDPALVTMIASSSMHADAWATALNALGREAGLAL-ANTLGLAVRYLEHNNDAFTYYSPAFT..... 302
77  2.000e-79 36  Chlorobium tepidum TLS gi|21673900||ref|NP_661965.1| ApbE family protein [Chlorobium tepidum TLS] gi|21 protmod 2 ......HRFGFRAMGSGCEIVLAGTKKKAKALAMLGMEEIAWIERKYSRYQPESVVSRINDAAGKWVACDDETSALLDYTDAVYRSSGGLFDVTSGVLRRAWNFD----KTEVPSQESLFPLLKLVGWQRVERRENDVRLP-QEGMQLDFGGIGKEYAADAAAEI-LCEEGVRHGYVNLGGDIRVIGPKPGGEPWTIGIRDPRDPGTIASISVSSGAIATSGDYERFFEVEGRRYCHIINPKTGFPVSQWRSVTVLAPLATTAGSCTTVAMLL-EADGLNYLKS---SGFNYLAINQSGEMYY.......... 291
78  2.000e-79 30  Dechloromonas aromatica RCB gi|46140989||ref|ZP_00203821.1| COG1477: Membrane-associated lipoprotein involve protmod 22 ..RTQLQEQQAYVFGTRVEVLVVSEDPEQRKAIAAVLREFDRLHRAYHAWQ-DSELMALNTAQGKTRQVSPELAAFVQEAQALSQQGDTLFDPGIGQLIKLWGFQADEFKAELPAAADIKAWLAKPSIADVVIDGTNIR-SRNRNVALDFGGYLKGVALDRASAI-LHAQGIHNALINIGGNVMALGSK-EGKKWRVGIQHPRQPGPMATVTLDDGAIGTSGDYQRFFEVDGRRYAHLLDPRTGYPVEHTQAVTVLIPKGTLSDAASKPIFIAGPDGWRDMARKMGTSLV--LRVDHSNQIFVTEALR..... 330
79  2.000e-79 25  Enterococcus faecalis V583 gi|29375798||ref|NP_814952.1| thiamin biosynthesis ApbE, putative [Enterococcus protmod 3 ......QSQTIYLMGTVIDVFVDHEE--SEKILEEVHQRLITYEQRFSANDSTSELMAVNQQAGQPVSVHPELYQLIALGKKHSCDPASHLNVTIGPLVQTWRIG--FKDARVPSEEEIKACLKKINPEKIHLNPLKQTVFLEEGMKLDLGALAKGYIADLLIAY-LKEVHVTSALINLGGNIVTLGPSHQNKKWRIGIRNPQEETISLLVEVANQSVVTSGIYERSLTEAGRVYHHLLDPTTGYPLEEMASLTIISDASVDGEIWTTRLFGYPIPEALEILNQLD--GIEGVIITQDQQILYSSGL...... 302
80  4.000e-79 26  Streptococcus agalactiae NEM316 gi|25011163||ref|NP_735558.1| hypothetical protein gbs1112 [Streptococcus agalac protmod 4 .......SHSLRLMGTTIDIQINSK--NAQKQIQEVIELLELYKNRFSANDFNSELMAINNNAGKPIQVHPDLFELITIGKEHSLARPGNLNIAIGPLVQTWRIG--FSDAKLPSPSEISEAMILSDPTHILLDSKNQSVFLNQGMKIDLGALAKGYIADKII-IYLKNEMIDSAIINLGGNVLVHGDNPNRSEWVIGIQHPKRGQNIGAVKIKNQSVVTSGTYERRLIIDDKEYHHIFDRQTGYPIQEMASISIVSKQSVDCEIWTTRLFGLSIKEALDILNA--VSYIEGIIITKDDRIYLSDGLK..... 304
81  4.000e-79 28  Desulfotalea psychrophila LSv54 gi|51244628||ref|YP_064512.1| related to thiamine biosynthesis lipoprotein (ApbE protmod 49 ......VTKTRLAMGTFVAITIHSSRDEAENAIGLAFEEIDRLNNVLSRYKQSTAVSELN-AEGVLKNPSLEIQEMIGRSLYFHRQTAGAFDITVGPLIDLYK--ESFAKAQQPGDAEIKEVLQRIGSQHLRFEGSGI-AMARPGMSITLDGIGKGYVVDRASEV-LVQNGVTNHLINAGGDIRASGNAAKGRPWTIAIQDPKHKDYPDIITMTDGAIATSGNYEIFYDRE-KIFHHIVNSKTGHSPQFLTSASITAKTVMDADAMATAVFVMEPKDAMVFIEN--QSESECFLIGEDKKIAKSSGWQ..... 344
82  5.000e-79 27  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50120898||ref|YP_050065.1| putative thiamine biosynthesis protein [Erwinia ca protmod 14 ............LMGSPILLKLFTHD---ETAVRQVFQRIKQLEDVLTVNRAQSEVMSINHAAGKYVSVSPVVFELIKRAKTVSLIENSGFNVAIGPVVKLWKIG--FSGCTVPDEESIHRALLLTHPERIILREQDCAVLLNAGMEIDLGAIAKGYIADIVRDV-LRQHAIQDALINLGGNVLAIGSALTDEQWSVGLQKPFADSLLGVIKVKNKSVVTSGVYERFFTVDDRIYHHILDPLTGYPLDNLHSVTIISNDSLDGDIYTTLLYGMGVSAGIHFLKNLQD--IEAIFVTKNKEIIFSSQ....... 306
83  6.000e-79 27  Xylella fastidiosa Temecula1 gi|28199436||ref|NP_779750.1| thiamine biosynthesis lipoprotein ApbE precursor [ protmod 1 .............MGTTWSVKLAAPRLDLHPLHNAIQARLDQIVAEMSTWEPNSHISRFNRAPVRWHPLPNDFDLVLRTALDIAMTSNGAFDPTVGPLVRLWGFGAYSGNHQIPTPEAITLATTRVGWQHLE-RTTDGHWLQPGGTELDLSAIAKGYSVDAVAAT-LHAKGVEHALVDIGGELYGYGHKPDGTPWSVLVENPLPP---CILQLDGLAVATSGDRWHHFEHEGQRYTHTIDPHQGTPIPDPALVTMIASSAMHADAWATALNTLGREAGLAL-ANTLGLAVRYLEHNNDAFTYYSPAFT..... 302
84  2.000e-78 25  Streptococcus mutans UA159 gi|24377466||gb|AAN58786.1| putative thiamine biosynthesis lipoprotein [Streptoc protmod 4 .......QQTLHLMGTTIDLMV--EADNAKELVETACQLLKTYEHRFSANSDDSELMAVNHLAGKPVQVQEDLFQLIKIGKKHSLEQPSNLNITIGPLVQAWRIG--FDDANIPSKSLIEKKLKLIDPQNIRLDEKKQTVFLQKGMKIDLGSLAKGYIADRVISY-LKQQGASSAMINLGGNLLVYGKKRSNGLWYIGIQDPKKPQNIGIVKIHGQSVVTSGIYERHLQINGKDYHHIFDKNTGYPIEQMASLSIISDLSLDGEIWTTRLFGLPIPFVMETINQISH--IEGIIITRDNRLAVSDGLK..... 304
85  3.000e-78 27  Streptococcus pyogenes SSI-1 gi|28895907||ref|NP_802257.1| putative thiamine biosynthesis lipoprotein precurs protmod 3 ......VTQQLKLMGTVIDIQIESDKACQQ--LSRVIDLLYTYKNRFSANDSNSELMAINQAAGKPVSVHSDLFNLIQIGKAHSLSTPSNLNIAIGPLVQAWRIG--FEDARVPSHNLISQQLALTDPRQVLIDDKKQTVFLQQGMALDLGALAKGYITDKIMAYLIE-DGIDSALINLGGNVRVHGPNPPDKTFRIGIQKPDAGQHLGVIKVNNHSVVTSGIYERQFTSKGKQYHHILDRQTGYPIEDMLSLTIMAPSSFYCDIWATRLFGLDSSMIITLLNTFDN--IEGLLVTRKHHVLMSNGLRHY... 306
86  3.000e-78 31  Treponema denticola ATCC 35405 gi|42528114||ref|NP_973212.1| ApbE family protein [Treponema denticola ATCC 3540 protmod 28 ......YSKTWLSIGTVCRVRILTSEPQAEEVLEKVYAELIKLDSIFNANTDESELERLNKEAGSPLEVSHELYELLQISLMMAELTDGAFNPAIGPLVKLWNIG--FENESVPSPEDIKEVLPLLDYKNIILSEGNKAFLQKEGMRLDLGGIAKGYAADKIAKILLE-HGIKDFLIDLGGNILVSGKNPSGKTWKTALRNPGKQNPVVSMNLQDASLVTSGNYERFIEKDGIIYHHIFDSKTGYPVQNSLASSIVSESSTLADALSTSSYVLGEEKTRALLQKL............................ 325
87  3.000e-78 29  Thiobacillus denitrificans ATCC 25259 gi|52006293||ref|ZP_00333674.1| COG1477: Membrane-associated lipoprotein involve protmod 31 ...PPLHQQQSYVFGTLVDVTVYGPEAQAREATAAVLARFDALHRELHAWQP-SALSRLNAARGESAAVTPELAAMLHDARELSIRSQHLFNPAIGGLVALWGFHADVPQRRVPDPAAIAGWVKARPRMSDLVIANNTVTTSNRAVQLDLGGYAKGRALDDAVAI-LKAHGIANALVNIGGNVIALGAHGE-RPWRVGIQHPREPGTLATLDLHDGAIGTSGDYQRYFEIGGRRYSHLIDPRTGRPATGMQAVTVLARAGTLSDALSKPLFIDGPA---HLAENAARLGVRYLAVDAAGKTHVSPDLAP.... 338
88  5.000e-78 27  Ralstonia eutropha JMP134 gi|46131695||ref|ZP_00170062.2| COG1477: Membrane-associated lipoprotein involve protmod 12 ....KRFRVTGATMGTRYSATFHASPETDESLAAELAAAVGAVDEQMSNWKDSSDLSRLNRAPNCWVQVSGNLAALLVRALEIGRDTHNAFNIGVGDLVGMWGFGPSGEQAHRPGGVGTSRASPCPPVSDLIVDVQQCRVRKREPVALDLCGIAKGFGVDELARV-LSEHGIGSWLVGIDGEMRARGSKPDGPPWAIALEAPDYDAAMAVIELSNAAIATSGDYRHWADIDGTRVSHTMDPRTGAPLCGVASVTVLAPTCADADAYATALLVLGLQAGRDY-AHCRRLDALFIVRDGD............... 310
89  5.000e-78 27  Shewanella oneidensis MR-1 gi|24375765||ref|NP_719808.1| apbE family protein [Shewanella oneidensis MR-1] g protmod 28 QPTPKMVKIEGEAQGTTWHISFWSPNINVKLVEDNINNRFDELDKNLSNYRPDSTISLFNSASTEPIVVGEEIVELVAQAKIVSDKSLGCYDLTVKSLFDLWGF--DKYQLMNPSAIAIAETLKDTGMQHIKI-KSNSMAKDRAQVHVDLSSIAQGYSVGELAEILERYN-IKNYLVEIGGEMVVKGYKPNGESWKVAIERPLPDKNILHKLLQDQAIMTSGTYRHYFDNNGVRLSHILDARTGYPVHNTVSVTVLHKNPMLADAWSTALLCLGHEKGIDIANE---NSINALFITDKNNEYSTNGFDLFTT. 341
90  7.000e-78 27  Streptococcus pyogenes M1 GAS gi|13622274||gb|AAK34010.1| putative thiamine biosynthesis lipoprotein precursor protmod 3 ......VTQQLKLMGTVIDIQIESDKACQQ--LSRVIDLLYTYKNRFSANDSNSELMAINQAAGKPVSVHSDLFNLIQIGKAHSLSTPSNLNIAIGPLVQAWRIG--FEDARVPSHNLISQQLALTDPRQVLIDDKKQTVFLQQGMALDLGALAKGYITDKIMAYLIE-DGIDSALINLGGNVRVHGPNPPDKTFRIGIQKPDAGQHLGVIKVNNHSVVTSGIYERQFTSKGKQYHHILDRQTGYPIEDMLSLTIMAPSSFYCDIWTTRLFGLDSSMIITLLNTFDN--IEGLLVTRKHHVLMSNGLRHY... 306
91  9.000e-78 25  Lactobacillus plantarum WCFS1 gi|28379808||ref|NP_786700.1| thiamin biosynthesis lipoprotein ApbE [Lactobacill protmod 4 .TQKKYVS-QFTMMGTVISLTLFEP---NQLAVEAVYDYLQRMDGVFSVNRADSELAAINQYAGHPVLVSTECFQLVSDAIKYTKQYADSFNVLIGPLVKLWKIG--FGGHQVPAAKGISQRLALLDTHEVILDEAQSSIYLRQGMQLDLGAIAKGYFADQVVK-QLQQAGITNAIVNLGGNVKLLGANPDNRRWQVGIQAPEAPGYPALVEMPARTVVTSGIFERYFKIGNHRYHHILDPRTGYPVENVDQVSIITERSELAEVLSTVAYFEGPNRGCQLIEQLPHT--EAIFIDHEQQVTVTSGLTP.... 309
92  1.000e-77 27  Porphyromonas gingivalis W83 gi|34396458||gb|AAQ65524.1| thiamine biosynthesis lipoprotein ApbE [Porphyromona protmod 24 RKAPAYTVLQGEIFHTYYHIKYKGEADHSQ----RVDSVFRAFNHSLNPFDSTSIIAGVNR--NLPVRTDSMFRRVFRRAQEIAAVSGGSYDITCSPLINAWGFGFEHKEDV--TAQLIDSIRAFVGYRRVRLDGET-VVKDDPRTTLNTSSIAKGYASDLVGE-ALAAHGIGDYMVEIGGEVAFNGLNPQGKPWRIGVSKPQDDSLGLVVELSGGGLATSGNYRNFYVRDGKKYAHTIDPLSGYPVQDVLSATVIAPDCMTADALATTFMVVGSERVPAIAAEFPGVDYMLILSDGDGKTVMNEGFR..... 332
93  1.000e-77 25  Streptococcus agalactiae 2603V/R gi|22537239||ref|NP_688090.1| ApbE family protein [Streptococcus agalactiae 2603 protmod 4 .......SHSLRLMGTTIDIQINSK--NAQKQIREVIELLELYKNRFSANDFNSELMAINNNAGKPIQVHPDLFELITIGKEHSLARPSNLNIAIGPLVQTWRIG--FSDAKLPSPSEISEAMILSDPTHILLDSNKQSVFLNQGMKIDLGALAKGYIADKIMTY-LKNEMIDSAIINLGGNVLVHGDNPNRSEWVIGIQHPKRGKNIGTVKIKNQSVVTSGTYERRLIIDDKEYHHIFDRQTGYPIQEMASISIVSKQSVDCEIWTTRLFGLSIKEALDILNA--VSYIEGIIITKDDRIYLSDGLK..... 304
94  1.000e-77 31  Methylococcus capsulatus str. Bath gi|53757223||gb|AAU91514.1| thiamine biosynthesis lipoprotein ApbE, putative [Me protmod 5 .....PFRFPFRAMGSPCHLILYAEETEARAVAREAIGEVQVLEARYSRYRPDSLLSRINAQAGSKVVVDDEMAALLDYARTCYEQSDGLFDVTSGILRRAWNF----AGDRLPEPRDVEALLERVGWNKLRWERPVLRFEV-PGMELDFGGIGKEYAADRAATRCLER-GITAGVVNLGGDLRVIGPHPDGTAWEVGINHPREPGLLATLSVRSGAITTSGDYERCITVDGRRYGHILDPRTGWPVQGLASVSVAASHALIAGSACTIAMLKASD-GPEWLRSL---GLPALWMDLDGRIGRHEA....... 299
95  1.000e-77 27  Streptococcus pyogenes MGAS8232 gi|19746085||ref|NP_607221.1| putative thiamine biosynthesis lipoprotein precurs protmod 3 ......VTQQLKLMGTVIDIQIESDKACQQ--LSRVIDLLYTYKNRFSANDSNSELMAINQAAGKPVSVHSDLFNLVQIGKAHSLSTPSNLNIAIGPLVQAWRIG--FEDARVPSHNLISQQLALTDPRQVLIDDKKQTVFLQQGMALDLGALAKGYITDKIMAYLIE-DGIDSALINLGGNVRVHGPNPPDKTFRIGIQKPDAGQHLGVIKVNNHSVVTSGIYERQFTSKGKQYHHILDRQTGYPIEDMLSLTIMAPSSFYCDIWTTRLFGLDSSMIITLLNTFDN--IEGLLVTRKHHVLMSNGLRHY... 306
96  2.000e-77 25  Streptococcus pneumoniae R6 gi|15903367||ref|NP_358917.1| Thiamine biosynthesis lipoprotein [Streptococcus p protmod 3 .....LRSHSERLMGTTITISLVDEQADI--FLQKSFDLLKELEYRFNANSQESELMEINYQAGAPVTVHPDLFELISLGLEHSLALSSHLNISIGPLIQTWRIG--FSDAKVAQPQEIESVLPLINPHGIELDSSTSTVFLKKGMKIDLGCLAKGYSADKVAQ-FLRKEGVTSALINLGGNILTIGKNRGDNPWQIGIQDPANPNHLMTIPVVNKSVVTSGIYERHLTVDGQDYHHIFDSQTGYPVEELASLTIISDKSVDGEIWTTRLF--GERPASILWQVESLEGIEVILIDKEGHLSCSSG....... 303
97  2.000e-77 31  Fusobacterium nucleatum subsp. vincentii ATCC 49256 gi|34762888||ref|ZP_00143871.1| Thiamine biosynthesis lipoprotein apbE [Fusobact protmod 11 .KEVEKIEESKFLFGTYIKIIVYSDKEKAMQSIEKAFNEIQRIDEKYNSKSEGSLIYNLNNSDNKSIKLDEEGIKLFEGVKKAYELSEHKYDITIAPLLELWGFTDETPDLKLPTKEEIEFTKTFVDFDKVKISDDGTLTIESPVKEIDTGSFLKGYAISKAKEI-LKADGIKNAFITSISSIEVIGTKPENKPWKIGLQNPENPDMIGIVPLKDRAMGVSGDYQTYVEIDGKIYHHILDKDTGYPIADKKMVVVLCDNAFDADLLSTTFFLMPIDKVISYVDSRKDLDV--LIVDKDMNIITSKNFK..... 319
98  3.000e-77 25  Azoarcus sp. EbN1 gi|56477232||ref|YP_158821.1| thiamine biosynthesis lipoprotein APBE precursor [ protmod 16 ....QRYNFSGATMGTRYSAVFFAEAGRDESALAALFAAVNKVDQQMSTWKPDSDLSRLNASPQQWVEVPEELVAVLATSLGVSRQSHGAFDIGVGALVNAWGFGPGTPQPDAHQISMLKKQAYQPACNVVDIDDANNRVRKRAAITLDLSGIAKGFGVDEMAR-CLDSFGITSYLVGIDGEMRARGLKPDGRAWAIAVEKPVRGEAMGVMEFTDAAIATSGDYRHWVQIADTYYAHTMNPSLGSPSTRVAAVTVVATTCMLADAWATALLVLGEDAGAQL-AQERNMNVLFVLRDGEGFQEIS......... 318
99  3.000e-77 28  Brucella melitensis 16M gi|17989355||ref|NP_541988.1| THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE PRECURSOR [ protmod 13 ........LNGPTMRTRWSIFYAAADFDIAPLRRALQQAVDEVDMQMSTWKPDSDLMRLNRAPGVWVEVPARLMEVLRLAIEIGRATGGAFDAAMGDAVKAWGFGPMEADQRLISEALAGPRVAA--HDALELDISAMRVRKRAAVTLDLNGIAKGYGVDRLADTLESF-GIHSGLVGIDGEMRALELRPDGTPWAIAVEMPDYNAPHSVLALHNGAVATSGDYRHWVVAGGHRLSHTMDPHRGAPSTPPASVTVVAKTCAQADAFATALMVLGPIAGSKLAQSL---GLDVLFLLRDGETIR.......... 306
100  4.000e-77 27  Ralstonia metallidurans CH34 gi|48770183||ref|ZP_00274527.1| COG1477: Membrane-associated lipoprotein involve protmod 1 .............MGTRYTAAYYAPPGMDEAVLAERLAAVGAVDAQMSNWKADSDLSRLNRAAGGWVPVSRNLATLLARALKIGSDTHNAFNIGVGDLVDRWGFGPSGAQCSHPDLGEAAGASPRPAGELIEVDERLCRVRKLGPVVLDLCGIAKGFGVDELGRV-LSEHGIESWLVGIDGEMRARGNKPDGGPWAIALEAPERRAAMGVIELADAAIATSGDYRRWADVGGARISHTMDPRTGAPAGGMASVTVVAKTCADADAYATALMVLGAQAGPDYARQR---GLDVLFIVRDGEALRT......... 294
101  1.000e-76 33  Rubrivivax gelatinosus PM1 gi|47575102||ref|ZP_00245137.1| COG1477: Membrane-associated lipoprotein involve protmod 29 .......RREEAIMGTSISVELWSEDPSAGAAMDLVIGEMHRIDRGMSPHKPDSELSRINREASRPVPLSEEMFALLARSLEFSRRSEGAFDITFAGAGRLY----DYRERIRPTDAALAQACAAVGHQYLELDAAARSVFARDGLRIDLGGFAKGHAVDNAAAILARR-GIRHAFISAGGDSRVIGDRR-GRPWTIGVRDPRRPGIIALLPLEDAAVSTSGDYERYFDPDGARCHHILDPRTGKSPDSVRSVTIIAPDGLTSEALSKCLFVMGVERGLRFVESH--AGVDAVVVDAAGALHYSSGL...... 325
102  2.000e-76 26  Pseudomonas syringae pv. syringae B728a gi|23469028||ref|ZP_00124363.1| COG1477: Membrane-associated lipoprotein involve protmod 13 ....KLESFGGPTMGSHYSVVYASGQPEPAAVRPEVEAILDEVDQQMSLWRADSDIERFNALPANSCQVPEPVLKLIGVGEQLAQESDGAFDLTVKPLMDLWGLGPHTLFEQMPLVRQLARTQALVGYRNLRIVGD--RLCKSAAVQVDLNSIAAGYAVDRISER-MDALGLHDYLVQATGELKVSGLKPDGSPWRVTLDAPLDDGTVTVFPLKGYAVSTSGDYRRYVDHAGWRISDTLDALSGKPIHSLASVTVIHPSALMADGLSSLLLILGPQRGWDYAQEHK-IPAFFVIRADKRFIIRSNA....... 316
103  3.000e-76 32  Fusobacterium nucleatum subsp. nucleatum ATCC 25586 gi|19705322||ref|NP_602817.1| Thiamine biosynthesis lipoprotein apbE [Fusobacter protmod 9 ....EKIEESKFLFGTYIKIIVYSDKEKAMDSIEKAFNEIQRIDEKYNSKSEGSLIYKLNNSSNKTIKFDEEGVKLFEGVKKAYELSGHKYDITIAPLLELWGFTDETPDLKLPTKEEIEFTKTFIGFDKVKISDDGTLTMGSPVREIDTGSFLKGYAISRAKEV-LKNEGIKSAFITSISSIDLIGTKPDNKPWKIGLQNPENPDMIGIVPLKDRAMGVSGDYQTYVEIDGEMYHHILDKDTGYPVKDKKMVVVLCDNAFDADLLSTTFFLMPIDEVISYVDGRKDLDV--LIVDKDMNIITSKNFK..... 314
104  3.000e-76 34  Microbulbifer degradans 2-40 gi|48861484||ref|ZP_00315385.1| COG1477: Membrane-associated lipoprotein involve protmod 53 .............MGTEISVTLWDEPEHAKLAITSVMTEMERINQLLSPYLETSELARVNRAATAPQKISEEFYWLIHHSLRVSALSGGAFDITFASVG--WRY--DYRAHQQPQENEIKNLLPAINYRLIVLDEKTRSVFKHKNVRIDLGGIAKGYAVDNAIKI-LRTMGVEHASVSAGGDSYLLGDR-QGRPWVVGIKNPRAEDPAAKIPLTDTAVSTSGDYERYFEHTGERVHHILNPKTGKSASEVTSVTILAPRGLDSDPLSTTVFVLGVEKGLELVNSLQ--GVDGIIIDRQGKVHYS......... 344
105  4.000e-76 26  Pediococcus pentosaceus ATCC 25745 gi|48871189||ref|ZP_00323905.1| COG1477: Membrane-associated lipoprotein involve protmod 9 ....ELVNKQHHALGTVINLSIAS--IYQVDILEKTIKMIDDFEDRLTVNRPSSEVMEINHQAGQAVQVSETTYRLIEKAVEVSRWQLG-FNVAIGPLVKLWKIG--FDGANKPSHAQILERIKLIDPQAIVLNAQNRSVFLKKGMELDLGGIAKGFIADEIKAYWQSEH-VASGIIDLGGNVLLVGRHPDAK-WKVGIQNPIKSRPLGVLHIPEKSVGTSGIYERKLIVEGQTYHHMFDSATGYPANNLASVSIVSDRSIDGEIWSTICFYQGIEKGKALLANQP--GIEAVFITRDLKVYVTDGLQ..... 310
106  9.000e-76 30  Azoarcus sp. EbN1 gi|56476872||ref|YP_158461.1| protein related to RnfF or ApbE [Azoarcus sp. EbN1 protmod 27 .TQPQLFHQEAYVFGTRVDLTVYGEPHEAAEAMGAVLQEFDRLHRAYHAWQP-SELTALNEARSEAAVVSDELAAMLTDAQQLSATGDGLFNPAMGALIGLWGFHADEFAPRLPDPAALRTVIEARPRMSDLVITGNRVESRNPVVQLDLGGYAKGYALDRAVAI-LRDKGIDNALVNIGGNVMALGKKGD-TPWRLGLQHPREPQPLATLPLYDGAIGTSGDYQRYFELEGRRYSHLLDPRTGMPATDSQSLTVLVDAGTLSDVASKPAFIAG-DDWREYTRRYDID--HALRVTAAGRIEVTRALR..... 335
107  1.000e-75 28  Lactococcus lactis subsp. lactis Il1403 gi|15673094||ref|NP_267268.1| thiamine biosynthesis lipoprotein [Lactococcus lac protmod 35 ...TSPINKDVTTMGTYIKVTVYDKG--KEAAVEKALKLPVEYNNLTTVNQSGSQIDEINQNAGKPIKVNSNVYELVKAGYNYSAKDLG-YDITIGSLTSLWNIGMD--NARKPAQSEIDQVLPLINYHDIKFDDKNETIYLQKGARLDLGSIVKGFVAMKMVD-SLKKDGVTTGIVNLGSSIYVIGHSPRGSPWTIGIKNPNDPTQMGIIKASNEHVNTSGIYERYLEVDGHKYSHILNPKTGYPENDIASITLLGKDKTNGDGLSTMIYAMGTKKGYEYVEKLKN--IEAVFVDKDNKVYITPGLKD.... 342
108  3.000e-75 28  Psychrobacter sp. 273-4 gi|52853470||ref|ZP_00145690.2| COG1477: Membrane-associated lipoprotein involve protmod 39 QQKTDYNNLSGETMGTSYHISYQLPKADKAAIQAAIDKRLQDINDSMSTYQADSIISEFNQLGKDPITIDADFSHVLAISRQVYQQSGGAFDPTVMPLVDTWGFGSTMTVERPPTALEIAQAKALVDFDSV-IQKDKTLYKTKDGIGLDFSAVAKGYGVDVIADVLKNNYQIRNYMVEIGGEVATSGVSAQQQPWQIAIDAPRERQTIAVINISNMHLATSGNYRNSVVFAGKHYSHTIDPTTGEPVGGAPSVTVAADTVALADAWATALTAMPYKKALS-VAKEQNIAALFVVLAEGVSVEA.......... 356
109  3.000e-75 26  Zymomonas mobilis subsp. mobilis ZM4 gi|56544312||gb|AAV90466.1| maturation factor of nitrous oxide reductase [Zymomo protmod 54 ..........GTTLGAPSTIKLYHKDEAAQKAIDAAREELDRLEAIFSIYRADSVLSRLNT-TGRIDKAPVEFMDLLGTALNIAKLTDGIFDPTIQPLWSLYHFMQEKPDPAGPAKSAIQQAMTKIGWQQINIDTANRNVFARPDMALTLNSIGQGYITDRVSDV-LRQHGFDSMLVDM-GEPRALKSRPDGKPWHIGIANPADPQAITEVNVRDKCVATSGGYGTLFDDNGK-FTHIINPKTGLTAPALMGVSVIAPNATIGDSLSTAMLLVPAEQRRPLLVA--GGGDKAIFVTPNG.............. 341
110  1.000e-74 27  Xanthomonas campestris pv. campestris str. ATCC 33913 gi|21232209||ref|NP_638126.1| thiamine biosynthesis lipoprotein ApbE precursor [ protmod 1 .............MGTTWSVKMVAPRRDLHPLHAVIQGALDRVVAQMSTWDADSDITRFNRAAGTWQRLPDAFHRVLTTALEIARASDGAFDPTVGPMVDLWGFGAAGGPRKVPSAEQIALARQRCGWQRLQLDAD--RALQPGALALDLSGIAKGFGVDCVQR-ALAQAGIASALIDVGGELFGYGRKPDGSAWRVLVEAPDEDAPARVLALDGLAVATSGDRWHRFEAGGVRYAHTFDPRLGAPVAQAAAAVTVLADAMHADAWATAMTVLGVDAGLAYATNAGLAVRFLQRRGADLQESMSPAF...... 299
111  1.000e-74 30  Ralstonia solanacearum GMI1000 gi|17549585||ref|NP_522925.1| PROBABLE THIAMINE BIOSYNTHESIS APBE TRANSMEMBRANE protmod 34 ...PAVQHASRRLLGTQVDIVAQAMPGAAAPAIDAAFAEMARLERLMSRYRPDSQVSALARAAGRPVPVAPELMAILKLAARLSARSGGAFDITVGA-FSGWNFDP--AQARIPSRAELVHEQRLVNYRDVVLDQARGRVYLRPGMKLDLGGVAKLPILQAGLRV-LRRHGVRDAMINGGGDVLVSG-QLQGHDWRVGLRNPLAPDLLGVVALSDGIVASSGDYERGFVRNGQRYHHILDPKTGLPTHGPHGVTLVARSVDDVNGLGAAIMVAGAEAGRRLL--VPPAGVDALIMGPGPRPWMSPGM...... 334
112  1.000e-74 26  Lactococcus lactis subsp. lactis Il1403 gi|15672350||ref|NP_266524.1| hypothetical protein L171943 [Lactococcus lactis s protmod 12 ......ISKTYRALGTVISLTIYGH--QDEELLDKTYQLIKYYEQLFTVNRDQSELMAVNHKAGEPVQVSGAVYGLTKIALEKSKEAFG-FNAAIGPLVKLWHIG--FSDAKLPTQAEIDEKLKIINPDRIILRDDEFSIFLPKGMEIDLGAIAKGYIADRIKDFW-HAYGISSGIINLGGNLLLVGEAPHDKKWRIGIRNPLTNDKKSVLQLGEGSVVTSGISERYLKVNDKIYHHIIDSKTGYPHHNLASVTILSKKSIDGEIETTRLFFADGPIENWLTENPEVYG--AIFISKDKKIKA.......... 307
113  3.000e-74 35  Magnetococcus sp. MC-1 gi|48831063||ref|ZP_00288145.1| COG1477: Membrane-associated lipoprotein involve protmod 22 ....KVENTTQLRMGTWVSISTLGQHG---AAVEAAFAEMGRLEKALSSHDPNSPISRINQGSNQWHPLDDETAQLLERGLIIQKASLNRFHMGLYHLSQLWGFMSETPLSQPPARQQATPNLEHAFSLSKQPDTTTLRIN-NPAFGLDLGAIAKGYAIDRAIAV-LRAHGVENAIVNAGGDLRVIGSKF-GQPWRIGIQDPTDKEVIARSDLQDRAMVTSGDYERFFIYQGRRYHHILDPMSGEPADGWRSVSVQAADAETADALSTALFTMDLAQGKRLLEQFP--GCQALWVDQQGEHQQSEGF...... 327
114  4.000e-74 26  Staphylococcus epidermidis ATCC 12228 gi|27467112||ref|NP_763749.1| thiamine biosynthesis lipoprotein [Staphylococcus protmod 14 ...........KAMGTVIRLSIEHQHPD--TLLQEAEIKIRAWESQFSANDPKSDLMNVNQHAGAPVKVSSEIFNMIRYGYETTLSSNFKMNILIGPLVKLWKIG--FKDALKPKEVDIQRALLCMNPENLVLNSKTHEVFLQSGMEIDLGAIVKGYFADQLQQYFLS-HGVSSAIIDLGGNVLTIGRQPETEKWHVGVRNPFHKDALPLVTLSHQSVVTSGIYERYFIQENQLFHHILDSTTGYPVNDIASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLID--GIEGIIVTRDGSVLMTSKMQKY... 311
115  4.000e-74 26  Staphylococcus epidermidis RP62A gi|57865763||ref|YP_189930.1| ApbE family protein [Staphylococcus epidermidis RP protmod 7 ...........KAMGTVIRLSIEHQHPD--TLLQEAEIKIRAWESQFSANDPKSDLMNVNQHAGAPVKVSSEIFNMIRYGYETTLSSNFKMNILIGPLVKLWKIG--FKDALKPKEVDIQRALLCMNPENLVLNSKTHEVFLQSGMEIDLGAIVKGYFADQLQQYFLS-HGVSSAIIDLGGNVLTIGRQPETEKWHVGVRNPFHKDALPLVTLSHQSVVTSGIYERYFIQENQLFHHILDSTTGYPVNDIASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLID--GIEGIIVTRDGSVLMTSKMQKY... 304
116  1.000e-73 24  Pseudomonas syringae pv. tomato str. DC3000 gi|28852550||gb|AAO55623.1| thiamine biosynthesis lipoprotein, putative [Pseudom protmod 29 ....KLESFGGPTMGSHYSVVYVAGQPDPVVMRPEVEAILADVDQQMSLWRSDSDIERFNALPANSCQISTSVLHLIRVGEQLSRESDGAFDLTVKPLMDLWGLGAHALFEQMPLVRQLARTRTLVGYRNLRIVGQQ--LCKNAAVQVDLNSIAAGYAVDRITER-MDALGVHDYMVQATGELKVSGLKPDGSPWRVNLDAPSDDDAPKLFPLTGHAMSTSGDYRRYRGGNGRHISDTLDALTGSPVHGLASVTVLHPSALMADGLSSLLLILGPERGWNYAQEHK-IPAFFVIRADKRFIIRSNA....... 332
117  6.000e-73 30  Ralstonia metallidurans CH34 gi|48771831||ref|ZP_00276173.1| COG1477: Membrane-associated lipoprotein involve protmod 38 .......HASRRLLGTRVDIVTDGPADAAAQAIDAAFAEMGRLERIMSRYRPDSQVSALARAAGKPVPIAPELMSALRLASEVSARSQGAFDITVGA-FEGWNFDPGH--EQVPGQAELTQERPLVNYRDVVLDSTRGSAYLRPGMKLDLGGIAKLPILQAGMDV-LRQQGISNAMLNGGGDVLVSG-RLQGRDWRIGLRDPLAPELLGVVAITDGVVASSGDYERCFARDGQRYHHILDPRTGLPTRGPHGVTLVARKTSDVNGLGAAIMVAGTAAGRSLLG--PMANVDALIVGPGSHPWMSEGM...... 334
118  1.000e-72 27  Brucella suis 1330 gi|23463623||gb|AAN33481.1| nosX protein [Brucella suis 1330] gi|23500036|ref|NP protmod 28 QGEQQPVIWQGQALGAPAKIIFYHPGRKAERLVGESAREAERLENIFSLYRPDSEIVRLNH-TGALASPAPEMVELLGICRTCWQLSDGLFDPTVQPLWQCKHFSQANPAPEGPSRAEWDAALAKIGFDHVLFNAERIAF-TKPGMALTLNGIAQGYVTDRVVG-LLRDAGVSEALVDM-GEYRAIGGQPDGKPWRIGIADLEAGAAPEFIDIMDQALATSSFAGFQFEESG-RFNHLLNPKTGYSAALYRRVTVVAPDTAMADALATAFSLMEPAQIKETLKKLP--GIFAYTVSRDGEKRR.......... 327
119  3.000e-72 26  Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough gi|46581202||ref|YP_012010.1| ApbE family protein [Desulfovibrio vulgaris subsp. protmod 31 .AQALPVTETRVQMGTYVGITVAGSAMQAEEALGRAFAEVARLEAVFSRFDGASPVSELNR-AGRLPDAPAELVTLVDRARRYGSLTDGAFDITVQPVVDLFRRNGNPRGTMHVDEADLKAARELVGLAHLQ-SGSGRLGFDRSGMGITLDGIAKGHIADMASAV-LTAHGVTDHIVNAGGDIMVRGMKAPGTAWRVAVASPNGGAYPETVRLTECAIATSGTSEVYFD-ARHQHHHLITPVAGRSPASTGSVSVIAPTVMEADALATALSVIPPQDALRLVASLPGRA--CCIFTRDGRRFTSSNWATF... 335
120  1.000e-71 25  Chlamydophila caviae GPIC gi|29840209||ref|NP_829315.1| thiamine biosynthesis lipoprotein [Chlamydophila c protmod 21 .STPKLTTLEGEKMTMPYRIVIYLSHEESEQLKKEIEAVFHVIDTVYNNWNRESEISKINHAAGVAIPLSKELCDFLKQVDSFYRISKGRFDPTLGPLKTLWLLH--LKQHSLPNEHVWKSYYENSGWKHIDLDVTNQTLTKKHDVQLDLCGAVKGFAVDCLLETCQHFC-VDSY-AEWGGEIKISGRHPSGRPWRIA-----SSATPEIIELKNTAVATSGNYYQQWSVNGKIYTHILDPHTGKPLEQIISAMVIHPSCAFADAMATVLMTFSTKTEALAWAKENHIEAF...................... 309
121  1.000e-71 28  Desulfovibrio desulfuricans G20 gi|23475453||ref|ZP_00130740.1| COG1477: Membrane-associated lipoprotein involve protmod 43 ......VTQTRLQMGTLVTLTVHTSRLQAEEALGRAFEEIDRLAAVFSRYDSTTPVYVLNR-DGRVSGIGPELKEVMDRALRFGSLTDNAFNITVKPVVDLFSSRQNLAGSVQLSQEDVSHALSLVDARGVQLGRDSIRL-QREGMGVTLDGIAKGYIVDKASSV-LSACGVRNHMINAGGDIRTSGEKAGGKPWVIAIQDPDKKNYPATIALRDGAIATSGGYEVFYDRK-RMYSHLVSPATGSSPHSVLSVSVTAPTVMEADTLATAVYVMQARSGLQFMDSL--TGRECLILGRNGAAYTSRNW...... 339
122  4.000e-70 28  Unknown gi|58338079||ref|YP_194664.1| thiamine biosynthesis lipoprotein [Lactobacillus a protmod 14 ..........HHALGTSITLQIFGT--QDRKLLQKSFDLIDHYEDLLTVNRDESEVMDINHAAGDPVQVSSAVYSLVKLAVEKSRENFG-FNALIGPVVKLWHIG--FKGACVPRDEEIKDKMILTNPFKVVLNDQDQTVFLKKGMELDLGGIAKGWIADRIRDLWL-AYGVEAGIINLGGNILLVGDSPKNGQWMIGIQDPKEPDNIASVMVPQCSAVTSGTYERYLVVDGHKYHHLIDPRTGYPVTDLAGVTTFTRYSVEAEIECKRLFFAGHP-----MKGWHDDPIGAVFVYNDEHVEY.......... 304
123  6.000e-70 30  Dehalococcoides ethenogenes 195 gi|57233636||ref|YP_182290.1| ApbE/NosX family protein [Dehalococcoides ethenoge protmod 40 ......YSETKTLLGTYITITVDSSRDNAEAKVKDTFAEIERLSSVFNRFDITSELYRLNKS-GQAIGASSEFVSVLSSAQYCAELSGGAFDPTVLPALDLCQDSFAKTKL-PPSVAQLDEVKYLVNYKEMSIKGKDVVLGRN-GMALTLDGIAKGYIVDKATEY-LRGRGVSQVIVEAGGDLALQGMREDGQPWKVGITHPRATGYYDVIQSSNACLATSGDYENAFTPD-YKYNHIIDPRTGFSPQELCSATVIARDTLLADALATAAMVMGVDETLKLLESLD--GAEALLIGKDLKSYTTSGYR..... 336
124  7.000e-70 28  Lactobacillus gasseri gi|23002954||ref|ZP_00046625.1| COG1477: Membrane-associated lipoprotein involve protmod 9 .....PISKVGRGLGTVITLQIYGDQ--NEKILNQSFDLIAGYEDRLTVNRDHSEVMDVNHAAGHPVQVSASTYNLIKLAVYESKQNFG-FNALIGPVVKLWHIG--FKGAHVPTDAQIKAKMSLTNPDDVVLDDANQTVFLKKGMELDLGGIAKGYIADRIRDLWRAYD-VRAGIINLGGNVLFSSPKRASGEWILGVQDPKRGDNLTTATVHECSAVTSGTYERFLEINGKKYHHIIDPKTGYPVQHVAGVTLFTRDSVQAEIECKRLFFAGGS--IPGWKNDKAGRYGAIFVYDDDSIER.......... 305
125  9.000e-70 28  Burkholderia pseudomallei K96243 gi|53719238||ref|YP_108224.1| putative thiamine biosynthesis lipoprotein [Burkho protmod 29 ...PQVYVQGTYVFGTRVQLALYGVPLDAQQATNAVFAHFQAMQRGLHAWQP-SEITRLNRAAGEPFRASPATAEILRAARRLSLDTQGLFEPGIGRLIRLWGFQSDQFRVAPPSPDAVRRELARARIADLAISPDGVVTSANRAVAIDLGGFAKGWALDDAAAI-LRRQGIANALIDVGGNLLALGSK-GGAAWRVGVQDPRKPGTLATLELRDGAIGTSGDYERFFQAEGVRYCHLIDPRSGFPAVQSEAVTVLVAPGPHAGALSDGASKPPFIAGRAAMPLARRLGVQALIVDAQGRVWATDAM...... 335
126  1.000e-69 26  Lactobacillus plantarum WCFS1 gi|28379385||ref|NP_786277.1| thiamin biosynthesis lipoprotein ApbE [Lactobacill protmod 32 ....QRRHQAHHALGTDIDLTLFGSDSDQY--LQAACDLIDQYEDRLTVNRTVSEVMAINQAAGQPVQVSAATYTLVRQAVELSRQHFG-FNALIGPLVKLWHIG--FTNAHVPEQSAINERLALIDPEAVICNDADFSVLLKTGMELDLGAIAKGYIADRIQDYWEAF-GQRAGMINLGGNLLMVGTHPDGQ-WRVGIQDPTTDNAIASVTIGPCSAVTSGIYERHLEFNGQSYHHILDSQTGYPRQDLESVTVFSKASIDGEIETTRLFFAG-QPIPDWATQRPDI-YGAIFVTKQRE............. 326
127  1.000e-69 28  Burkholderia mallei ATCC 23344 gi|53725327||ref|YP_102712.1| ApbE family protein [Burkholderia mallei ATCC 2334 protmod 29 ...PQVYVQGTYVFGTRVQLALYGVPLDAQQATNAVFAHFQAMQRGLHAWQP-SEITRLNRAAGEPFRASPATAEILRAARRLSLDTQGLFEPGIGRLIRLWGFQSDQFRVAPPSPDAVRRELARARIADLAISPDGVVTSANRAVAIDLGGFAKGWALDDAAAI-LRRQGIANALIDVGGNLLALGSK-GGAAWRVGVQDPRKPGTLATLELRDGAIGTSGDYERFFQAEGVRYCHLIDPRSGFPAVQSEAVTVLVAPGPHAGALSDGASKPPFIAGRAAMPLARRLGVQALIVDAQGRVWATDAM...... 335
128  2.000e-69 28  Lactobacillus johnsonii NCC 533 gi|42519773||ref|NP_965703.1| hypothetical protein LJ0552 [Lactobacillus johnson protmod 9 .....PISKVGRGLGTVITLQVYGDQ--NKKILDQSFDLIAGYEDRLTVNRDHSEVMDVNHAAGHPVQVSASTYNLIKLAVYESKQNFG-FNALIGPVVKLWHIG--FKGAHVPSDEQIKEKMSLTNPADVRLDDDNQTVFLKKGMELDLGGIAKGYIADRIRDLWRAYD-VRAGIINLGGNVLFSSPKRASGEWILGVQDPKRGNNLTTATVHECSAVTSGTYERFLEINGKKYHHIIDPKTGYPVTHVAGVTLFTRDSVQAEIECKRLFFAGGP--IPGWKNDKAGRYGAIFVYDDDSMER.......... 305
129  4.000e-69 25  Rhodobacter capsulatus gi|435531||emb|CAA51405.1| rnfF [Rhodobacter capsulatus] gi|1075548|pir||S39899 protmod 192 ......VSETFYVFGTLLEVETHGPEAQARDAMAVLGAHFRQMHRDWHAWAPG-ELESLNAAAGQSFEVDPGLAKLLQQGRDLACRSEGLFDPAVGGMVEAWGFHADTPPEAIRSDAVVAKLLAAPKMTDLTITGTTVR-SSNPAVQLDLGAYAKGAALD-LAEADLTAAGIRDAVLNAGGGVQVLGDH-GSRPWRVAIRDPFEWGVVGAVSLRPGALHTSGNYERYFDRGGIRFSHIIDPRTARPMRGVVSVSVLSDNGALSDAAATALCVAGEEDWPRIAAQMGVRAV--LRITDDGSIFATPEMR..... 492
130  6.000e-69 24  Chlamydophila pneumoniae TW-183 gi|33236189||gb|AAP98278.1| thiamine biosynthesis lipoprotein precursor [Chlamyd protmod 25 .......TIEGEQMTIFYRIVLGTSLSAKEKASQQIDRCFHKIDSIYNNWNPYSELSIINRAPADPITLSVELSEFLDQVDTLYKLSEGRFDPTVGPLKTLWLLH--LKSQTLPPKDVWEQHYKDMGWQHLEFQSNTKTIKKNPHVQIDLCGVVKGYAVDCLNEICNTFC--PNNYVEWGGEIKTSGHHPSGRPWRI-----FSEAAGTILDIDDMAIATSGNHIQKWCVEGKIYTHILDTRTGKPLEPIQSVSVVHPSCAYADAIATVLMTFDSKEAKQWAEEH............................ 302
131  1.000e-68 23  Buchnera aphidicola gi|4321103||gb|AAC32332.2| hypothetical protein [Buchnera aphidicola] gi|6686388 protmod 29 ......IKLKGKTMGTYWQVKIVPNQLHIKNLIQRKLDEDEKL---LSSWKKNSLVSKFNKKKNQLLAIDKKFFKIISIALKINKKTYGKLDITIGNLINIWGFGNQKKPHNYPSINKIKQVMALTGMKHLSLISNANKHYIKKGMKINLSTLGEGFAADHLSSV-LKKEGIENYTISIGGTVLVKIKNKENSK-IIAIQKPTDQSIHLLIHLKNKSISTAGTYRNYYYLKGKKISHLIDPKTGMPVHNLISVSVISSTALEADGWDSALLILGFKKA-KILALRENLAVCLITKKNNTFTWISPCFKKF... 336
132  2.000e-68 28  Shewanella oneidensis MR-1 gi|24373663||ref|NP_717706.1| apbE family protein [Shewanella oneidensis MR-1] g protmod 1 .............MASPCELLIASHDETAYDMLDMAAREAYRIEQKYSRFIEGNYLWQLNHAQGKSVAIDEETWQLLSFAKQCFVLSNGLFDISACPLMQVWRF---TQDAILPAKVDIDAARALVGFERLEFNSRELKI--PAGMQLDFGGIAKEYAVDSVAYELAESYPKISVLVNFGGDIAC--PVAHSVPWQVGIEDPNRDHAAKVLAITQGALATSGDTRRFIEVDGRRYGHIVDPRTGYPVRAPRSVTVLGPNCVTAGMLATMAMLQGEQAEAFLTEQ............................. 267
133  3.000e-68 23  Chlamydia trachomatis D/UW-3/CX gi|15604796||ref|NP_219580.1| hypothetical protein CT077 [Chlamydia trachomatis protmod 21 .SAPSRTTLEGVRMTIPYRI-VFGEALSPQQAQKEIDRVFDHIDQTFNNWNPLSEISRINRTTKQPIPLSPALFAFLCEIDHFHAFSDGRFDPTLGALKSLWLLH--LKSHTIPSQELQHLYKHSSGWHLISLDKTQQTLKLSPLVQLDLCGTVKGFAVDLLGTACAQFC--QNYYVEWGGEIKTKGKHPSGRSWAVA-----SSATPEILHLHDHAIATSGSQYQRWHVDNKTYTHILDPLTGTPSHPILAVSVINESCAFADAMATALTTFSSKQ--EALDWANKKHLCAYITDKN............... 314
134  1.000e-67 29  Cupriavidus necator gi|38637915||ref|NP_942889.1| NosX [Cupriavidus necator] gi|32527253|gb|AAP86003 protmod 36 ...PRVAQSSRTLMGTRVDITVQAHADTAAPAMAAAWAEMARLADLMSRYRVGSQVHALQLAAGQPVKVAPEMLRVLGMANRMSRRSAGAFDITVGAFAG-WNFDPAHP--AMPDQAEIARELPLVNYRDVVVDPRAETAFLRRGMRIDLGGIAKLPVLQAGMDV-LRQHGLDGAMINGGGDVLVSG-ALQGRAWRIGVRDPLAPALTGVIAMHDGLVAASGDYERCFMQAGRRYHHILDPGTGMPSAGPHGVTLVARGVDDINGLGAAIMVAGETAGRHWLEALP--GVDAMIVGPGGRRWLSAGM...... 336
135  8.000e-67 29  Brucella melitensis 16M gi|17989312||ref|NP_541945.1| NOSX [Brucella melitensis 16M] gi|17985179|gb|AAL5 protmod 59 .....................................QEAERLENIFSLYRPDSEIVRLNH-TGALASPAPEMVELLGICRTCWQLSDGLFDPTVQPLWQCKHFSQANPAPEGPSRAEWDAALAKIGFDHVLFNAERIAF-TKPGMALTLNGIAQGYVTDRVVG-LLRDAGVSEALVDM-GEYRAIGGQPDGKPWRIGIADLEAGAAPEFIDIMDQALATSSFAGFQFEKSG-RFNHLRNPKTGYSAALYRRVTVVAPDTAMADALATAFSLMEPAQIKETLKKLP--GIFAYTVSRDGEKRR.......... 320
136  9.000e-67 25  Chloroflexus aurantiacus gi|53796956||ref|ZP_00357849.1| COG1477: Membrane-associated lipoprotein involve protmod 2 ......QQISFRAMGSTITIIVDSADPTARSALTSARKIFLHHEQILSRFRPQSELSVLNRAAGQPRRVGRTLWQAVCHALRIARLSQGLVTPTVGAALIEAGYDRDFGMLIASHRQSIQTPVAIPSWQRITCDPYRRTIALPAGVQLDLGGSAKGWT---AAIVARRLGKRFPSLVDAGGDIALSGPRRDGTPWPVEIADPRQPDTIELLLVRRGGIATSGIDYRRWQHNGRWMHHVIDPCTGAPAQDVLAATVIASSLPLAEMAAKMVVILGSDEGLRWLNARPDLA--GLLVTTDGTVIRTATLT..... 301
137  1.000e-66 28  Bradyrhizobium japonicum USDA 110 gi|27375431||ref|NP_766960.1| NosX protein [Bradyrhizobium japonicum USDA 110] g protmod 36 ......VRWRGSALGAQVSIDIFHPDEEAERIIQDCLTEVRRLEGQFSLYRADSAICALNRS-GILVAPEPDMVALLKASLQFSDLTGGTFDPTVQPLWQLYHFSSENPDPGGPPAGKLAEALAKVGSSGLRVS-EKLVALLRHGAAITLNGIAQGYATDRVVDV-LRARGLSTTLVNM-GEIRALGARADGTPWRVGLSDPRAGALTETIDLIDRAVATTAGAGFRFDPAG-RFTHLFDPRTGRSPALYRTVSVIAPTATEADALSTAFSLMPASQIGDIAATRPDVQVRLITNDGNLRLY........... 330
138  1.000e-66 25  Magnetospirillum magnetotacticum MS-1 gi|46202221||ref|ZP_00208438.1| COG1477: Membrane-associated lipoprotein involve protmod 29 .AQARLVRWEGTTLGAPSTIQLFSTDAQARAALAAAQAELARLEAIFSIYRADSALSALNR-DGKLDNAPAEFVELAAHAKSLAAISDGAFDPTIQPVWQLYHFTAANPDAAGPSRKDLDAALALVDWKGIEIDPAGRRVALRPGMALTLNARAQGYITDKVAEV-LRAHGFTQMLVDM-GEPRAMEAKPDGSAWRIGIANPADNSAVTSVDVINKCVSTSGGYGTIFDEAGK-FTHIIDPRTGKTAPADLGVTVIADNATIADGLATALILAPEAKRAHILRA--GGAEKAFFVTPEGVV............ 327
139  2.000e-66 29  Bradyrhizobium japonicum gi|3850619||emb|CAA05524.1| nosX [Bradyrhizobium japonicum] gi|11352857|pir||T44 protmod 36 ......VRWRGSALGAQVSIDIFHPDEEAERIIQDCLTEVRRLEGQFSLYRADSAICALNRS-GILVAPEPDMVALLKASLQFSDLTGGTFDPTVQPLWQLYHFSSENPDPGGPPAGKLAEALAKVGSSGLRVS-EKLVALLRHGAAITLNGIAQGYATDRVVDV-LRARGLSTTLVNM-GEIRALGARADGTPWRVGLSDPRAGALTETIDLIDRAVATTAGAGFRFDPAG-RFTHLFDPRTGRSPALYRTVSVIAPTATEADALSTAFSLMPASQIGDIAATRPDVASSGLI................... 322
140  2.000e-66 29  Rhodopseudomonas palustris CGA009 gi|39935135||ref|NP_947411.1| putative nosX [Rhodopseudomonas palustris CGA009] protmod 34 ....EPVRWRGSALGAQVSIEIHHPDVAAERLVERSVRAVHRLEQMFSLYRPDSAICALNRS-GVLIAPDRDVVALLQTTLDFAAQTGGAFDPTVQPLWELYHFERTGADPSGPAKADVAGALAKVGYDGVLVSADRIAL-KRPGAAITLNGIAQGFATDRVVD-LLRKGGMTSTLVDI-GEIRAIGARPDGVPWRVGLADPETTSALGTVDLVDRAVATSSGAGFRFDPAGQ-FTHLFDPSTGRSPSLYRSVSVVAPTATEADALSTAFSMLDRGRIGTIVQAR--AGVEVLLAHAEGSV............ 327
141  3.000e-66 24  Chlamydia muridarum gi|7190390||gb|AAF39210.1| thiamine biosynthesis lipoprotein, putative [Chlamydi protmod 51 ........FEGVRMTIPYRVVLGESFSQKKQAQKEIDQIFDHIDQIFNNWNPFSEISRINRSETEPISLSPELFSFLCEIDRFHTFSDGRFDPTLGALKNLWLLH--LKSQTLPPQELLHSYKQNTGWHLLSLDKTNHTLKLSPSVQLDLCGAVKGFAVDLLGIFCSQFC--QNYYVEWGGEIKTSGKHPSGRSWAIA-----SSATPEILHLNNSSIATSGNQYQRWYVNKKIYTHILDPLTGIPLEPILAVSVIDENCAFADAMATALTTFTSKEALDWAKK............................. 326
142  3.000e-66 24  Chlamydia muridarum gi|13626129||sp|Q9PKW2|APBE_CHLMU Thiamine biosynthesis lipoprotein apbE precurs protmod 28 ........FEGVRMTIPYRVVLGESFSQKKQAQKEIDQIFDHIDQIFNNWNPFSEISRINRSETEPISLSPELFSFLCEIDRFHTFSDGRFDPTLGALKNLWLLH--LKSQTLPPQELLHSYKQNTGWHLLSLDKTNHTLKLSPSVQLDLCGAVKGFAVDLLGIFCSQFC--QNYYVEWGGEIKTSGKHPSGRSWAIA-----SSATPEILHLNNSSIATSGNQYQRWYVNKKIYTHILDPLTGIPLEPILAVSVIDENCAFADAMATALTTFTSKEALDWAKK............................. 303
143  1.000e-65 30  Rhodopirellula baltica SH 1 gi|32472682||ref|NP_865676.1| probable thiamine biosynthesis lipoprotein apbE [P protmod 22 ....DLLELKHRAMACDFVVLVPDERVGNRSVADVVLRAIEEIESSLTVYRGDSEIARVNALAEKPVHLKPATFELLQKANALAERTQGAFDITAGPLVETWGFT--KREGRKPKPDEIESARERVGWKRLILDVESRTARFAKGMSLNMGAIGKGHAIDVLAA-SMRADGMCDFLIHAGGDQQPVATSDENKGWLVGVSHPTRPGKLGGLWLRDEALSTSGSGKQFFHHQGKRYGHVIDPRTGYPAGQWLSLTLTTTHAVDADALSTALFVMGKDDAKAYAAEH---GIGLILVSAGKRQE........... 337
144  3.000e-65 26  Zymomonas mobilis gi|6478235||gb|AAF13759.1| NosX [Zymomonas mobilis] protmod 54 ..........GTTLGAPSTIKLYHKDEAAQKAIDAAREELDRLEAIFSIYRADSVLSRLNT-TGRIDKAPVEFMDLLGTALNIAKLTDGIFDPTIQPLWSLYHFMQEKPDPAGPAKSAIQQAMTKIGWQQINIDTANRNVFARPDMALTLNSIGQGYITDRVSDV-LRQHGFDSMLVDM-GEPRALKSRPDGKPWHIGIANPADPQAITEVNVRDKCVATSGGYGTLFDDNGK-FTHIINPKTGLTAPALMGV............................................................ 297
145  4.000e-65 27  Microbulbifer degradans 2-40 gi|48861346||ref|ZP_00315249.1| COG1477: Membrane-associated lipoprotein involve protmod 22 ...........KLMASECEIHIRTSEASAQKTITQAYREAKRIEQHFSRYITGNALHTINNSPNTPITLDTEYCELLNYALTLYDISDGMFDISCGALRHLWRF--NTTEQQPPTQAQLDAALSNIGLNKIHWSAPQLT--LPQGMELDFGGIGKEYAVDKAAQVI---QGFFDYLVNFGGDCYCKGS--AESPWTIAVENSPADATNNTVTLLEGGVATSGTTKRFFTSGGKRFGHILNPKTARPAHAPLSVTVVHQSCLSAGALATLAMLEG-KAAEQYLQEQE........................... 292
146  7.000e-65 25  Shewanella oneidensis MR-1 gi|24372996||ref|NP_717038.1| apbE family protein [Shewanella oneidensis MR-1] g protmod 39 QGKGSINTLKYF--GTSITIDIYEADKDKAYLALCVVQEYHYLASNFSTYPGYTNIQTINNNPEKLHHIDAKLTEILTTSIEWHGITQGRFNIALAPVLEVWRYRKRCQQGELPSDTELANAAKHIDIKQITLDANNNTIQMKAGMKLDLGGIAKGWMVEKVYD-QLKADNINAFMINAGGNIRHFGTHPDGRQFITAIENPNGDIYHEIIQGEDITIVSSGNYLNYYAVNGQEYHHIIDPTTLYPKKQGISVSVIMKNPILADVISTSLFLLPMPEAQDLIKRIGDIEAVW-FLDEQGHKIATPQFEQY... 369
147  7.000e-65 22  Buchnera aphidicola str. Bp (Baizongia pistaciae) gi|27904710||ref|NP_777836.1| putative thiamine biosynthesis protein ApbE precur protmod 23 QKKYETVFLCGYTMGTTWKVKIINNRLTYYNLKKKIEKQLCYDNNQISSWNKNSDISNFNKNTTKPQKINKNLAKLISIGLLVGKKTNNLLDITSGTLINIWGFGPTSRKHSIPSKKTIKLAQMLTGLNHIKLLINKQQYYLQPKLQINLSTLGEGFAADNLKRI-LDDEGINDYYISIGGTVVTHTSPKNSQNKIIAIQKPTDNEIHCLISLKNNAVSTSGTYRNYYTLH-KKIIHIINPITGNPANDLVSVTVISKSALKSDAWDTGLILLGFRQAKKI--SIQEKLAVCLIKKNKSFTWTSPQFKKF... 338
148  8.000e-63 28  Magnetospirillum magnetotacticum MS-1 gi|46203242||ref|ZP_00208863.1| COG1477: Membrane-associated lipoprotein involve protmod 28 .......TRAGLAFGTTVALTVAGPDTTLDAALSDGFAAMRAVEAAASLFRADSALARLNR-AGRLDAPPEPLLAMLRFALALAERTEGAFDPTVQPLWPVWA--EASARGERPDPADLREAVARIGWRRVGLTPE--RIVLEPGTALTLNALIQGYAADRVMA-ALRERGIADAFVD-TGEFGAVGTHPDGTPWRLGIADPRAPEAAAVIAPFLGFAATSGDYNMSFSPD-RADHHIFDPATGHSPGGLSSVTVTAETGLVADGLSTACMVLGPERGGRLVAGWPGCSLRFI.................... 307
149  1.000e-62 29  Clostridium tetani E88 gi|28211471||ref|NP_782415.1| putative thiamine biosynthesis lipoprotein apbE [C protmod 42 ............TMTVVVGYTKSEEEFNSMEKIHSRFQELHKLYDIYNNYEGINNIKTINDNAGKPVKVSKDIIDLIVFSKKWYKLTEGKVNIAMGSVLSIWHDIDNPENAKLPPMKELLDASEYTNIDKVIVDTKKSTVYLDKRMSIDIGAVAKGYATEIVAKEII-NEGFKSGIISAGGNVRVLDKPLDGKRWGIGIQDPKKDKNIDTIFINNASVVSSGDYQRYYVVDDKKIHHLIDTKTLMPGEYYHAVTVVAKDSGLADLLSTAVYLIPYNKSRKLVESLE--GVEAIWVMLDGKIEATEGMK..... 350
150  3.000e-62 24  Haemophilus influenzae 86-028NP gi|48867508||ref|ZP_00321008.1| COG1477: Membrane-associated lipoprotein involve protmod 10 ..KNKVISLSGKTMGTTYHVKYLDDGATSEKTHEEIEAILKDVNAKMSTYKKDSELSRFNQNTNTPIEISADFAKVLAEAIRLNKVTEGALDVTVGPVVNLWGFGPEKRPEKQPTPEQLAERQAWVGIDKIALDMSGAKPTLSPQVYVDLSSIAKGFGVDQVAE-KLEQLNAQNYMVEIGGEIRAKGKNIEGKPWQIAIEKPTERAAEAVIGLT................................................................................................... 231
151  3.000e-61 27  Parachlamydia sp. UWE25 gi|46447336||ref|YP_008701.1| putative Thiamine biosynthesis lipoprotein apbE pr protmod 47 .....VTTFQDVVMTVQYRILVGNSEVDKIRIQTIIDSTFEEIDTIYNKWNPQSEISRLNSKAFQTIPLSPQLFQLFKQIDALVILSEGLFDPTIEPLQKLWKEKLN--SQQLPSPDEIALIKPSIGWDKIHFE-KGIFFKENSLTELDLGGIAKGFAIDLLISR-LNEAGFPNLYVEWGGDIRTSGRHPAKRPWNIYISHLDSKDAIAFLSLNNQAIATSGDYFQYWTVELQTYCHIFNPLTLSPLKSIASASLVANDCLTADALAKVMMLFDSKEEAEQWSQIPSLAYWMLIR.................. 351
152  7.000e-61 26  Sinorhizobium meliloti 1021 gi|16263101||ref|NP_435894.1| NosX protein required for nitrous oxide reduction protmod 36 ......VTWRGRALGAPATLILLESQADAAGLVDRVVAEVARLERVFSLYQRDSALAELNR-TGAIAAPPPDLVNLLEASRDFWETTGGAFDPSVQPLWTLYHFAAGDADPAGPPEAAKRRALSRVGFDKLEFNRDR-VVFARPGMALTLNGIAQGYITDRIVG-LLKDAGIANSLVSM-GETRAIGSQHDGRPWRVGLATREDASTPDVLNLVNRAVATSSPDGFRFDDSG-RFGHILDPLSGRAPRLRRRVSVVAPTATAADAFSTAFSLMGSSAVRIACEHHSELTVDMI.................... 321
153  1.000e-60 26  Sinorhizobium meliloti gi|2177178||gb|AAB69119.1| NosX [Sinorhizobium meliloti] protmod 23 ......VTWRGRALGAPATLILLESQADAAGLVDRVVAEVARLERVFSLYQRDSALAELNR-TGAIAAPPPDLVNLLEASRDFWETTGGAFDPSVQPLWTLYHFAAGDADPAGPPEAAKRRALSRVGFDKLEFNRDR-VVFARPGMALTLNGIAQGYITDRIVG-LLKDAGIANSLVSM-GETRAIGSQHDGRPWRVGLATREDASTPDVLNLVNRAVATSSPDGFRFDDSG-RFGHILDPLSGRAPRLRRRVSVVAPTATAADAFSTAFSLMGSSAVRIACEHHSELTVDMI.................... 308
154  1.000e-59 26  Desulfitobacterium hafniense DCB-2 gi|53684077||ref|ZP_00344227.1| COG1477: Membrane-associated lipoprotein involve protmod 3 .ARVAVHELRGLSMGTTWSVKLAAPVAALIDLERGIQARLDEVVAQMSTWETGSDISRYNRAAGSAHTLPAPFAEVLAAALALAADTDGAYDPSIGPLTDLWGFGPAGARAQTPEPAPLAQARERVDWRRLRFDPTTRELIQPGGAYLDFSSIAKGYGVDRVADWLL-AQGCGDCLVEVGGELRAHGRKPDGSAWRVAVEQPHEDEATAVIALDGLAIATSGD.......................................................................................... 225
155  8.000e-59 28  Deinococcus radiodurans R1 gi|6459567||gb|AAF11346.1| nosX protein, putative [Deinococcus radiodurans] gi|7 protmod 28 ....PPYRLRERLLGTEVEVVVAGTRAQAEAAENAALDELERLTAVLNRFDPSSEFSRWLASPGERVRLSPELLAVLERAEHWQQVTGGAFHPGADALGALWQ--AAAARGEAPDPAALARELRAPLWTR----HGDGSATVHARFPLGLNAFAKGFIVDRMAETAFAAPGVRAVLVNAGGDLRTLG----GDGLSVAVADPRDDAPLTTVWVQNGALATSGGARRGHRVGKKWHSHLLDPRTGQPVEAVPGVTVTAPDCAMADALATALSVLAPADGLRLADETPGCA--ALLVTRDGAQLQSTNWR..... 330
156  3.000e-58 23  Psychrobacter sp. 273-4 gi|41690580||ref|ZP_00147112.1| COG1477: Membrane-associated lipoprotein involve protmod 8 QTTPQLATIKLFAMGCHIQISLYTTRLSAQYLTSDVQQRLAYWEHIFSRFDDTSELMRLNNRGDQWSEVSSELFEVLQHAIHFVLKTQGLVTPTLLQPLWAAGYKHSFEGLSAPSNVQDTTSANHANQQRIQLRDGQHQVYLPTGMALDLNGYVKGWCAMQLAEHISRVHWHIPCLVDMGGDI-AIGIPRDDKPWGVAVAKPQNDEDVAILKLSSGAVATSGDYRRWW-HDGRWQHHLIHPHDSRPVTDVLTATVLATDTMTAEVYAKYCLLLGVKVAMAWLNKY---HIAALLIDTDNKVMATSAIRP.... 355
157  4.000e-56 26  Rhodobacter sphaeroides 2.4.1 gi|22958092||ref|ZP_00005772.1| COG1477: Membrane-associated lipoprotein involve protmod 192 ......VRETFYLFGTLVEIETHGPERMARAAIARAGQSLEAAHRDWHGWRPG-ELGTLNTAAGRPQRVDATLAALLRKGRALSCASGGLFDPAIGRLVGAWGFHADTLPEGDPPAAIAALVARHPRMTDLRFDGTEVR-SLNPAVQLDLGAYAKG-AALEMAAAELRAAGVEDAVLNAGGGVQVMGRHGA-RPWRVAIRDPFQWGVVAGVSLRPGALHTSGNYERYFDRGGVRFSHILDPRTGRPMQGIVSVSVLDTDGARADAAATALCIAGREAWPRVAAAMGVRAVLMI--ADDGAVFATPEM...... 492
158  2.000e-55 32  Listeria monocytogenes str. 1/2a F6854 gi|47097674||ref|ZP_00235189.1| thiamine biosynthesis lipoprotein ApbE, putative protmod 2 ..........................................................................................................................LPLINYKDVKMNDKDQTVYLKEGMELDLGAIAKGFITDETLKVF-KENKVTTSIIDLGGNIYVQGNNPNGNKWNVGIQDPFSPSVIGKLPESNMSIVTSGIYERYLEVDGKTYHHILDPKTGYPDNDIAGVSIVSKKSIDGDGLSTATFSKGIKGGMDYIEQFE--GVDAIFISKEKKVYETSGLK..... 188
159  3.000e-55 29  Paracoccus denitrificans gi|5764065||emb|CAB53356.1| NosX protein [Paracoccus denitrificans] protmod 29 .......HWVGQALGARASIRIDHPE--AGAITARCLAEIDRLENILSLYRPGSALARLNR-DGVLDAPPFELLDCLSLAGAVHRASGGLFDPTVQPLWSLWA--EAAVNGRRPTPEERRDALARTGWDRVRLDAA--RITLEPGMALTLNGIGQGYVADRVAA-LLEAEGLGDILID-TGELRALGGRPDGRDWPVRLAE------GGAVGLRARALATSAPLGTSFDEAG-RDGHILDPLSGAPARPVWAVSISAPGAGLADALSTAACLADLQEIRALLDRFDGTRLEA..................... 299
160  2.000e-54 25  Escherichia coli gi|1736855||dbj|BAA15997.1| ORF_ID:o373#4~similar to [SwissProt Accession Number protmod 2 ..........................................................................................................................KAKTGLQHLTVINQSHQQYLQPDLYVDLSTVGEGYAADHLAR-LMEQEGISRYLVSVGGALNSRGMNGEGLPWRVAIQKPTDNAVQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIHNLVSVTVIAPTALEADAWDTGLMVLGPEKAKEVV-RREGLAVYMITKGDSFKTWMSPQFKSF... 194
161  3.000e-53 29  Aquifex aeolicus VF5 gi|15606483||ref|NP_213863.1| hypothetical protein aq_1258 [Aquifex aeolicus VF5 protmod 16 .......ERVFYLMGTY----LILDELRGKEV--AVYKYMKKLEEKLSHFIPDSEISRINENAGKPVKVSKETYEILKISKEIAEKTYGYFDPTVGS------YTVNFKMKKLISE---KKAKSLINFKDLILFPEERKVFLRKKMALDLGGIGKGFAVQKAYEYIKTEKG----FIALAGDMKVWGHKR-----KLAVYNPINGKILAEVNKKDLCLSTSGNYFR---------KHIL----GKS-KRVLQITVAHENCTVADALATALFASPEKEREKILKNFPEAAV--LILYTDGSLFVNGKFRDF... 281
162  4.000e-50 40  Desulfitobacterium hafniense DCB-2 gi|23116037||ref|ZP_00100806.1| COG1477: Membrane-associated lipoprotein involve protmod 2 .....................................................................................................................ELKELLPLVNYKNLLIEGNT-AYLKQAGQMVDLGGIAKGYAGDAAIEVY-KKQGITSAFINLGGNVVTLGTKPDGSSWTVGVRNPREDQIVGMITVADKAVVTAGDDQRYFEVDGVRYHHILNPHTGYPAQDLMSVTLVTDSSLLADALDTAVYILGLEKGREMLE.............................. 170
163  1.000e-48 31  Burkholderia pseudomallei K96243 gi|53722486||ref|YP_111471.1| putative thiamine biosynthesis lipoprotein precurs protmod 224 ..................................................................................................................................LEVDVARGRARRLADVAFDLCGIAKGFGVDELARVLDR-HGIGAWLVGIDGELRARGCKPDGSPWAIALEAPDYDGAMGAIDLVDAAVATSGDYRHWADFGGERLSHTMDPRAGAPLRDIASVTVVAPTCTDADAYATALMVLGAQAGCAHAERH---GLDALFVVRDGDALRT......... 396
164  2.000e-48 31  Burkholderia mallei ATCC 23344 gi|53717512||ref|YP_105498.1| ApbE family protein [Burkholderia mallei ATCC 2334 protmod 219 ..................................................................................................................................LEVDVARGRVRRLADVAFDLCGIAKGFGVDELARVLDR-HGIGAWLVGIDGELRARGCKPDGSPWAIALEAPDYGGAMGAIDLVDAAVATSGDYRHWADFGGERLSHTMDPRAGAPLRDIASVTVVAPTCTDADAYATALMVLGAQAGCAHAERH---GLDALFVVRDGDALRT......... 391
165  3.000e-48 33  Ralstonia solanacearum gi|17427622||emb|CAD14141.1| PROBABLE THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE PRE protmod 13 ...........PLLGTLVDITVRGPDATLQAALDAAFAAVERVQRLMSFHAEDSDVSRINAAAGSAVCVDAQTYCVLERAVALGELSDGVFDIATAGVLVEQGFLPRHAGAQPPAPGAT--------FRDLILQADHRVQWRRKG-WIDLGGIAKGYAVDCAIA-ALRAHRVDSGIVNAGGDLRCFGRAEP-----IHVRRPDAPATLVPLWLHDLAIATSGGYFAGIERDGRQIDPLVDP--GRRACAVWSISVVAADCMTADALTKVV........................................... 258
166  1.000e-47 21  Trypanosoma brucei gi|23928423||gb|AAN40014.1| NADH-dependent fumarate reductase [Trypanosoma bruce protmod 41 ......YATSGLELTVPYALKVVASADTAKEVADEVLRAWQLADTVLNSFNPNSEVSLVGRLPGQKHQMSAPLKRVMACCQRVYNSSAGCFDPSTAPVAKALREIALGKERNNACLEALTQACTLPN--SFVIDFEAGTISRKEHASLDLGGVSKGYIVDYVID-NINAAGFQNVFFDWGGDCRASGMNARNTPWVVGITRPKEASYISVISLDNEALATSGDYENLYTADDKPLTCTYDWK-GKPSQNIAQVSVKCYSAMYADALATACFIRDPAKVRQLLDGWR........................... 339
167  5.000e-47 27  Mesorhizobium loti MAFF303099 gi|13475525||ref|NP_107089.1| similar to thiamine biosynthesis lipoprotein [Meso protmod 7 ............LMGMPITVDIGGTSTDD--LIDTVFGYFEHIDRRFSTYRADSEIAAINRGDVPVVDWSGEMMEVFALAQQTKDQTDGYFDI------------------------------------------------RKPDGSLDPSGIVKGWAIRNAAGIVQRA-GISDFFIEAGGDIQSCGKNASGHDWSVGIRNPFTDEIVKIVYPRGRGVATSGTY--------VRGQHIYNPHIGHPIQDVVSLTVIGADVLEADRFATAAFAMG-RDGILFIEQT--LGLEGYLVDANGRATPTTGF...... 241
168  2.000e-46 25  Streptomyces coelicolor A3(2) gi|7106693||emb|CAB76095.1| putative thiamine biosynthesis lipoprotein precursor protmod 1 .............MGTVFSFDVRGGEPAARAALDEAVAGLHRADEVFSTYRDGSQISRLARGELTVAACAPEVAEVLELAAEAERVSDG------------W-FSTRYRGRLDPT------------------------------------GIVKGWAVERAARGIAAACGASGVSVNGGGDVQLLGTPGAVRPWRVGVSDPLRPGGLAAVGVTELAVATSGSAE--------RGAHVVDPRTGRSVTDLLSVTVVASRLTWADCWATAAFAMGSREGLRWLDSLP--GVEGLLITAGDEVRCTGGL...... 241
169  2.000e-46 27  Streptomyces avermitilis MA-4680 gi|29610432||dbj|BAC74479.1| putative thiamine biosynthesis lipoprotein precurso protmod 1 .............MGTVVSFDVRGGDPQAGTALEEAVAGLHRVDEVFSTYREQSQISRLARGELTVEECDPEVAEVLGLGAEAERVSEG------------W-FSTRYEGRLDPT------------------------------------GIVKGWAVERAARH-LVAAGASGVSVNGGGDVQLYGVPGPHRPWRVGVSDPLRPGALAAVGVPELAVATSGTAE--------RGAHIVDPRTGRSVTDLVAVTVVGPRLTWADSWATAAFAMGSREALAWLESLPD--VEALLITAGDEVRCTGGL...... 240
170  1.000e-44 25  Paracoccus denitrificans gi|3492850||dbj|BAA32544.1| ORF2 [Paracoccus denitrificans] protmod 19 .ARAATEEWQGRAMGADVTLRLHGSPVQARGFFAEAARLLAHVENLFSLHR-DSDLVRLNR-DGRLRFPAAGMVELLALSDRLHRATGGAFDPTVQPL---WLARARGEDE--------ATARALAGWQAVDWSQAEVRL-TRPGMALTFNGLAQGWAADRLAEAAAR-HDLAELLIDA-GEIRALGV----RDWRVGLADAAGRE-HRRIRLRDRAVATSSPGGTLIGPHG--LPHIVAPGGGVPLWDTISVS--ADSAALADGLSTALCLMPPKAACAAMARLPGCRIELAIAAQDAE............. 293
171  1.000e-44 25  Achromobacter cycloclastes gi|4914313||gb|AAD09162.2| NosX [Achromobacter cycloclastes] protmod 32 .........TGQALGARASIRIAHPE--AGTIVSRVMAEIDRLENILSLYRANSALCRLNR-DGHLQDPPFELLECLSLADAVHLASGGRFDPTVQPLWTLWA--QSAANGTRPGPADVDRVRGNVGWGKVKLGAAAIT--LHPGMALTLNGIGQGYVADRVAAM-LEVEGLTDILID-TGEFRALGGRPGGGGWPVRLE------TGERLPLRQRAVATSAPLGTTFDQAA-RDGHILDPLTGMPAPA................................................................ 255
172  5.000e-44 23  Bacteroides thetaiotaomicron VPI-5482 gi|29348992||ref|NP_812495.1| thiamine biosynthesis lipoprotein ApbE [Bacteroide protmod 1 .............MGTRLDILMIHSNLPLLNMLWAITDELERLDKMLNRFDATSEVSKLNSHTQQSVSVSAELEDILRSCQYYYEKTLHLFDIT------------------------------LNDFSQIQIHGNHHISFSNFSVTLDFGGFAKGYALKKIQEILLRGN-IENAFVDFGSSIMGIGHHPYGDCWKVSLQNPYTQQTLDEFCLTDNTLSTSGNTEQY-------TGHIINPLTGIYNEQKKVTSILSDNPLDAEILSTVWMIADDQQREQINENFKH.......................... 239
173  1.000e-43 26  Bacteroides thetaiotaomicron VPI-5482 gi|29348877||ref|NP_812380.1| hypothetical protein BT3468 [Bacteroides thetaiota protmod 25 .............MHTRVDIILCCQKSENELVVNSIYDTLRQLERIANYYDPSSELSQVNQRASTPVMISQSLYRMISLCTEYHKKTLGCFDVTI--------HSDNYNQDTIHSIHLYPEAQS--------------VFFQQAGTTINLSGFLKGYALDKIREI-LKVHIIANALINMGSSVLALGNHPVGTGWKVSFDDQTKNHKTQSILLNNECLTTSGN-----NSDDRK--HIISPSSGKPLEGVRQVTVVTDDGTTGEILSTSLFVANQKQRELIMSEF............................ 273
174  1.000e-41 25  Paracoccus denitrificans gi|2370352||emb|CAA04668.1| NirX protein [Paracoccus denitrificans] protmod 19 .ARAATEEWQGRAMGADVTLRLHGSPVQARGFFAEAARLLAHVENLFSLHR-DSDLVRLNR-DGRLRFPAAGMVELLALSEPAAPPTGGAFDPTVQPL---WLARARGEDE--------ATARALAGWQAVDWSQAEVRL-TRPGMALTFNGLAQGWAADRLAEAAAR-HDLAELLIDA-GEIRALGV----RDWRVGLADAAGRE-HRRIRLRDRAVATSSPGGTLIGPHG--LPHIVAPGGGVPLWDTISVS--ADSAALADGLSTALCLMPPKAACAAMARLPGCRIELAIAAQDAE............. 293
175  1.000e-38 23  Streptomyces avermitilis MA-4680 gi|29605838||dbj|BAC69903.1| putative thiamine biosynthesis lipoprotein precurso protmod 5 ..........EHVMGFPVSLRIDDEGDFDAAADAVFAWLREA-DARFSPFKADSEVSRLDRGELREDALSADLLEVLDLCEHYRAATGGAFDV------------------------------------------------RLPGRGLDPCAVVKGWSVQRAAE-LLSAAGARRFCLN-----AGGDVAAAGGPWRVGVRHPEADKLCTVLELTDGAVATSARYE--------RGDHIRDGRTGRPATGLLSLTVVAPTLTEADSVATAAFAMGTE-GVEWAAGLDGCEVFA--VDAERRVLRTAGL...... 236
176  3.000e-37 22  Bifidobacterium longum NCC2705 gi|23464780||ref|NP_695383.1| hypothetical protein related to thiamine biosynthe protmod 24 ............ALGT--GLLVHTESVLDDEIRDRIGSFIHEYEVVLSRFRDDSIVGRMRTAAGGTFDFPDWASGLFGLYDRLFAATDGATDPCVGDLIRL-GYDESYSFTPAPDAAEHAGAIHGRAIWSADVERHGTTLVTRGPVALDFGACGKGYLVDLLAGMLGDGAGHIQYVIDAGGDLLV----HTDEPITIALEDPADPAAVGTVEISHGAFASSPSRRHWSDAAGHQLHHLLNAIDGLPVDDVAAVAVTPPSSTLADGLATALFTTPATQ.................................... 324
177  5.000e-37 26  Exiguobacterium sp. 255-15 gi|45531186||ref|ZP_00182252.1| COG1477: Membrane-associated lipoprotein involve protmod 2 .......ERQLYSMHN--NIRFITNQRIEEKEWQDIEQFFHYVDRQWSRFSSSSEVSQLNQLIGQTLTVSLPLARLLQRAIHYFEQTEHYFSPFL-----LEQQRANGYDRSFPFRRAVESEMNLP-PEISPFLVEGCEVTRVGGGTIDLGGIGKGAAAMMAAQRLRKNQ--SRGLIEAGGDVIAWS---DDEPWKIAVTDPKTETEIAEIRLRQGAVATSSRMYRSWKVGDRTNHHLLSGKTGRPIESRVQITASAPQLYEAEVMTKLAFMTESERQNKLFKWFPNG--RLLLMDESGKMVAEE........ 287
178  3.000e-35 30  Thiobacillus denitrificans ATCC 25259 gi|52006512||ref|ZP_00333892.1| COG1477: Membrane-associated lipoprotein involve protmod 10 .............LGTLVEIVAEGDDATLIAASDRAFARIAAVHAQMSFQAADSALSRVNRAQHDWVTLSPDLAAVFAAALAFARASDGLFDPSVGRLVES---GQLPRHTGFPDA-------TTTDWRGIELDGDRVRYTQP--LLVDLSGIAKGYAVD-VALTSLRDAGLAAATVNAGGDLARFG---GATP--IHVRLPQQPQSVRLAELDHGAAATSAGY---FQPGALRH-----PRSGEALCAETSVTVLAPDCMTADALTKVVAADSACAAGVLARH----GAQAIVLDGQRAI............ 271
179  4.000e-34 28  Haloarcula marismortui ATCC 43049 gi|55380116||ref|YP_137965.1| thiamine biosynthesis protein [Haloarcula marismor protmod 25 ..................TFRIQATGIRAETAATAAQETAESLEAQLNAFDEMSAVSQLNRE-GEI--ANEHIARIVRRGLEYNDRTDGVFDIYQGRLHELKTFL-RGDSETPPD-----------GFDTGTVRTSGPHVTT--DIKLDLNGLAKGYIVDRASEAL---GGVRRGFVSGGGDM----SPPTG---PVAIESPYGDDTPLKILDTDWYVATSGGYRR--SRNGT--DHVYDPTTSLGSRHELVTVVVRRDCMEADALATTIAALPLAEARELASEWE--GLEALIIHDGVFH-PTEGF...... 282
180  1.000e-33 29  Rhodopirellula baltica SH 1 gi|32472662||ref|NP_865656.1| probable thiamin biosynthesis lipoprotein apbE [Rh protmod 3 .......ELKHRAMACDFVVLVPDERVGNRSVADVVLRAIEEIESSLTVYRGDSEIARVNALASKPVHLKPATFELLQKANALAERTQGAFDITAGPLVETWGFT--KREGRKPKPDEIESARERVGWKRLILDVESRTARFAEGMSLNMGAIGKGHAIDVLAA-ALRADGMCDFLIHAG..................................................................................................................................... 179
181  7.000e-33 30  Thermus thermophilus HB27 gi|46198950||ref|YP_004617.1| hypothetical protein TTC0642 [Thermus thermophilus protmod 11 ............VLGSFLEVQLLAPPWRARRAFGAVLREVRRLEAVFSRHRE-SELTRLVRQGGG--RPSPEMREVLAAALALKEATGGAFHPAPAHGGEAFRFVGEEVEVLAP---------------------------------LDLDGLAKGYIADK-GAEAALRAGARAALVNLGGDLARKGPGRAE----VLVEAPFGPDNAPPVHLGEGGVATSGVR--------HKGPHLLDPRKGRPAFGL-QATVLAPSALLADGLAKALFVLGEEA.................................... 228
182  1.000e-31 21  Shewanella oneidensis MR-1 gi|24372674||ref|NP_716716.1| ApbE family protein, putative [Shewanella oneidens protmod 2 ......IRRAKPLLGTLIEIAVESDEPAIQAAITAAFSRITQIGRLLSFHQQDSELNLLNRQPGQWITLSQDSLRVFKLAKWFGKASDNLFNCTIGGEMMSRGALPCYLG--MP-------LLLQGDWQDIEIRGNQARLARP--LIVTFDGIAKGYAVDMAVRELRRA-GVSGGWVNAGGDLKVFGSASLDVLCR------GSNGLSQKVTVRNMALASS............................................................................................ 208
183  2.000e-29 27  Neisseria meningitidis Z2491 gi|7380594||emb|CAB85182.1| hypothetical periplasmic protein [Neisseria meningit protmod 51 .........KGVALGSGAELRLFGDDRRAADLVNKVLAEVARLEKMFSLYREDSLISRLNR-DGYLTSPPADFLELLSLCRDIHALTEGAFDPTVQALWKLYAFAAHPDAETPPPQNSVDEALKRVGFGKVSFDDREIRFA-EKGMGLSLNGIAQGY............................................................................................................................................................ 199
184  8.000e-29 23  Bifidobacterium longum DJO10A gi|46190587||ref|ZP_00206523.1| COG1477: Membrane-associated lipoprotein involve protmod 1 ........................................................MRTAAHGGT-FDFPDWASGLFGLYDRLLAATDGAIDPCVGDLIRL-GYDESYSFTPAPDAAEHAGAIHGRAIWSADVERHGTTLVTRGPVALDFGACGKGYLVDLLAGMLGDGAGHIQYVIDAGGDLLV----HTDEPITIALEDPADPAAVGAVEISQGAFASSPSRRHWSDAAGHQLHHLLNAIDGLPVDDVAAVAVTPPSSTLADGLATALF.......................................... 251
185  2.000e-22 26  Oenococcus oeni PSU-1 gi|48864959||ref|ZP_00318828.1| COG1477: Membrane-associated lipoprotein involve protmod 57 ..........................................VDHIFSPFRTNSELTLYNHRKIEMTGTNLLFQEVFALSIWAKEMTQGLF-------------SANFVGKYNPT------------------------------------GAVKGWAIEKAERIQLEPLLSDPNFVNGGGDMQFSSSDKHNWQWEIGIVNPFDNKVISCFRMKNGAIATSGT--------SQRGEHLFNSSTGRAIPNVISSSVIGSELTYSDIWATAI........................................... 236
186  1.000e-18 20  Burkholderia mallei ATCC 23344 gi|53717512||ref|YP_105498.1| ApbE family protein [Burkholderia mallei ATCC 2334 protmod 20 .........SGATMGTRYGAQFYAPPTDARAIAAALDAAVRAVDAQMSNWKADSDLSRLNRAPGSWTPICANLAAVLVRAREIGRETDNAFNIGVGTLVDRWGFGPGAAANRQADNERAANRQA............................................................................................................................................................................................. 136
187  1.000e-18 21  Burkholderia pseudomallei K96243 gi|53722486||ref|YP_111471.1| putative thiamine biosynthesis lipoprotein precurs protmod 20 .........SGATMGTRYGAQFYAPPTDARAIAAALDAAVRAVDAQMSNWKADSDLSRLNRAPGSWTPICANLAAVLVRAREIGRETDNAFNIGVGTLVDRWGFGPGAAANRQ-ADNEWAANRQAAGRHTV...................................................................................................................................................................................... 142
188  1.000e-14 27  Thermus thermophilus HB8 gi|55980970||ref|YP_144267.1| hypothetical protein TTHA1001 [Thermus thermophilu protmod 1 .............MGSFLEVQLLAPPWRARRAFGAVLREVRRLEAVFSRHRE-SELTRLVRQGGG--RPSPEMREVLAAALALKEATGGAFHPAPAHGGEAFRFVGEEVEVLAP---------------------------------LDLDGLAKGYIADK-GAEAALRAGARAALVNLGGDLARRGP............................................................................................................................. 138
189  7.000e-13 18  Escherichia coli gi|405941||gb|AAA16405.1| yojL [Escherichia coli] protmod 32 ...TEVTVLEGKTMGTFWRASIPGIDAKSAELKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSSPWPVSEAMADIVTTSLRIGAKTDGAM.............................................................................................................................................................................................................................. 121
190  8.000e-05 22  Buchnera aphidicola gi|6478276||gb|AAF13786.1| unknown [Buchnera aphidicola] protmod 1 ........................................................................................................................................................................................................................................................NLVSVSVISSTALEADGWDSGLLIMGFKKAKKLI--LKEKLALCLITQKKNSTWTSPQFRKF... 62



Contact us