Homologs of:

1vq3_A mol:protein length:94 Phosphoribosylformylglycinamidine Synthase, P
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# E-value %id Organism Protein Model Start LPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVKKACEELLVNPVVEEYEVRELEnd
7.000e-29 30  Synechocystis sp. PCC 6803 gi|16331800||ref|NP_442528.1| hypothetical protein slr0519 [Synechocystis sp. PC protmod 14 ...YHCRIYVTLRPSVLDPAGTAVQSGLQQLGYDGVSQVRIGKYIELTLEAPDEATASQQLDTMCDQLLANTVIENYCFEI. 91
2.000e-28 33  Crocosphaera watsonii WH 8501 gi|45528453||ref|ZP_00179652.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 5 ...YHCRIYVTLRPSVLDPAGVAVQSGLHQLGYEGVEKVRIGKYIELTMTAEDQTQAETQLDEMCDRLLANPVIENYSYEI. 82
5.000e-28 34  Brucella melitensis 16M gi|17987406||ref|NP_540040.1| PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE, PURS C protmod 1 ..MIKARVTVTLKNGVLDPQGKAIVGALGSLGFDGVSSVRQGKVFDLELEGSDKAKAEADLKAMCEKLLANTVIEDYSIAI. 79
6.000e-28 32  Synechococcus elongatus PCC 7942 gi|46129510||ref|ZP_00202062.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 MTRYHARIYVTLRPSVLDPAGAAVQTGLQHLGYDSVEQIRIGKYIELSLQAETEAIAREQLDQMCDQLLANPVIENYRFEL. 81
1.000e-27 36  Agrobacterium tumefaciens str. C58 gi|17935734||ref|NP_532524.1| hypothetical protein Atu1844 [Agrobacterium tumefa protmod 1 ..MIKARVTVTLKNGVLDPQGKAIEGALGSLGFDGVGHVRQGKVFDLELEGADKAKAETDLKAMCEKLLANTVIENYAISIL 80
3.000e-27 28  Magnetospirillum magnetotacticum MS-1 gi|23013895||ref|ZP_00053744.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 2 ....KAKVHITLKNGVLDPQGKAVQHALGSLGFGGVNDVRQGKYIELDLAETDRAKAKDAVEQMCKGLLANTVIENYAIEL. 78
4.000e-27 32  Sinorhizobium meliloti 1021 gi|15965526||ref|NP_385879.1| hypothetical protein SMc00494 [Sinorhizobium melil protmod 1 ..MIKARVTVTLKNGVLDPQGKAIEGALGALGFDGIGQVRQGKVFDLQLETADKAKAEADLKAMCEKLLANTVIENYSISL. 79
3.000e-26 30  Rhodospirillum rubrum gi|48763263||ref|ZP_00267818.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 6 .PTVKAKVHITLKSGVLDPQGKAIANALAHLGFDGLGEVRQGKVIEIELAETDPAKARDSVDAMCRKLLANTVIENYAIEI. 85
3.000e-26 35  Mesorhizobium loti MAFF303099 gi|13470378||ref|NP_101946.1| hypothetical protein msl0067 [Mesorhizobium loti M protmod 6 ....KARITVTLKNGVLDPQGKAIEHALSGLGFDGVGAVRQGKVFDVELAESDKAKAEADLKAMCDKLLANTVIENYSVTL. 82
10  1.000e-25 35  Mesorhizobium sp. BNC1 gi|45682887||ref|ZP_00194321.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MIKARVIVTLKNGVLDPQGKAIEGALRGLSFSDIGSVRQGKVFDLELEGADKAKAEAELKEMCERLLANTVIENYSISI. 79
11  3.000e-25 29  Bartonella henselae str. Houston-1 gi|49475722||ref|YP_033763.1| hypothetical protein BH09720 [Bartonella henselae protmod 2 ....KARVIVTLKNSVLDPQGEAIIGALKSLSFTGIHSIRQGKVFDIVLDDQSAKNAKQTLEQMCEELLANTVIENYTIELL 79
12  5.000e-25 32  Bartonella quintana str. Toulouse gi|49474335||ref|YP_032377.1| hypothetical protein BQ07480 [Bartonella quintana protmod 2 ....KARVTVTLKSRVLDPQGEAIAGALKSLAFTGIHSIRQGKVFDIVLDDQSADNAKKKLEKMCEELLANTVIENYTIELL 79
13  8.000e-25 29  Anabaena variabilis ATCC 29413 gi|53764385||ref|ZP_00160185.2| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 5 ...YLAKIFVTLRPSVLDPAGVAVQSGLQQMGYDNVDHVRIGKYIELNITTSDEAKARQDLDRICDQMLSNPVIENYRFDLI 83
14  8.000e-25 29  Nostoc punctiforme PCC 73102 gi|23126824||ref|ZP_00108708.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 5 ...YLAKIFVTLRPSVLDPAGVAVQSGLQQLGYDNVDQVRIGKYIELTITSTEEKKARQDLDRICDQMLANPVIENYRFELI 83
15  1.000e-24 30  Moorella thermoacetica ATCC 39073 gi|49236523||ref|ZP_00330582.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MLLAKIHVTLKPGVLDPQGEAVGKGLKAMGYGGVAAVRVGKYLEIMLNLDDREEAGRLVEEMCRRLLANPVIEEYRYSL. 79
16  2.000e-24 32  Caulobacter crescentus CB15 gi|16126731||ref|NP_421295.1| hypothetical protein CC2492 [Caulobacter crescentu protmod 2 ....KATVHVFLKPGVLDVQGKAVENALHGLGWPSVKDARVGRVIEFDLDATDAEAAKAEVKTMCEKLLANTVIESYRIDV. 78
17  2.000e-24 25  Thermosynechococcus elongatus BP-1 gi|22299728||ref|NP_682975.1| hypothetical protein tsr2185 [Thermosynechococcus protmod 1 MAQFQAQVFVTLRPSVLDPAGVAVQAGIHHLGYTNVQSVRIGKLVELTLEAGDRATAEAQLGHIADQLLANPVIETFRIEL. 81
18  3.000e-24 33  Geobacillus kaustophilus HTA426 gi|56418796||ref|YP_146114.1| phosphoribosylformylglycinamidine (FGAM) synthaseP protmod 1 ..MYKVKVYVTLRESVLDPQGTAVKGALHSLSYTEVKDVRIGKFMELVMEESDRD-INELVREMCEKLLANPVIEDYRYEI. 78
19  3.000e-24 33  Trichodesmium erythraeum IMS101 gi|48893424||ref|ZP_00326660.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 5 ...YQVYIYVTLRPSVLDPAGTAVKSGLAQMGHKNLEQIRIGKYIELKLNATDEETAREQVELICDQLLANPVIENYRFEL. 82
20  5.000e-24 24  Thermoanaerobacter tengcongensis MB4 gi|20807291||ref|NP_622462.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 1 ..MLIAKVYITLKKGILDPQGKAVKGALHSLGYEEVKEVRVGKYIELTFEDGDLSLLKDKVDEMCKRILTNPIIEDYTFEI. 79
21  6.000e-24 29  Nostoc sp. PCC 7120 gi|17131566||dbj|BAB74173.1| asr2474 [Nostoc sp. PCC 7120] gi|17229966|ref|NP_48 protmod 5 ...YLAKIFVTLRPSVLDPAGVAVQSGLLQMGYDNVDHVRIGKYIELNITTSDEAKARQDLNRICDQMLSNPVIENYRFDLI 83
22  1.000e-23 32  uncultured Acidobacteria bacterium gi|31789374||gb|AAP58491.1| putative phosphoribosylformylglycinamidine synthase protmod 13 .PM-KARVFVTLKPSVFDPQGQTIADALHSMGYAGVGDVRQGKYFELELAAASADQARALAAEVADKLLANPVIESYRVEI. 91
23  1.000e-23 35  Gloeobacter violaceus PCC 7421 gi|37520011||ref|NP_923388.1| hypothetical protein gsl0442 [Gloeobacter violaceu protmod 3 ...YKATIRVTLRPSVLDPAGVAVRSGLQQLGYASVANVRIGKYIELELEADNDAEARHQVDRLCDQMLANPVIEVYKFEV. 80
24  1.000e-23 30  Prochlorococcus marinus str. MIT 9313 gi|33862813||ref|NP_894373.1| hypothetical protein PMT0540 [Prochlorococcus mari protmod 14 VPRFHARVLVSLRPSVLDPAGEAARSAANRLGVEGISKLRIGKVVDLELEADNEAEARKQLELLSDRLFANPVIEDWSLEL. 94
25  3.000e-23 29  Bacillus licheniformis ATCC 14580 gi|52079130||ref|YP_077921.1| PurS [Bacillus licheniformis ATCC 14580] gi|520023 protmod 1 ..MYKVKVYVSLKESVLDPQGSAVQHALHSMSYKEVQDVRIGKYMELTIEKSDRDL-DVLVKEMCEKLLANTVIEDYRYEV. 78
26  5.000e-23 35  Prochlorococcus marinus subsp. marinus str. CCMP1375 gi|33240303||ref|NP_875245.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 1 MPNFKAKVQVSLRPSVLDPAGEAAKSAAIKLGVKGISKVRIGKAIDIEIEAPNKQDAIEQVEILSDRLLSNPVIENWSLQL. 81
27  5.000e-23 29  Bacillus subtilis subsp. subtilis str. 168 gi|16077714||ref|NP_388528.1| required for phosphoribosylformylglycinamidine syn protmod 1 ..MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSDRDL-DVLVKEMCEKLLANTVIEDYRYEV. 78
28  6.000e-23 35  Bacillus clausii KSM-K16 gi|56962802||ref|YP_174528.1| phosphorybosylformylglycinamidine synthase PurS co protmod 1 ..MYKVKVYVTLRESVLDPQGGAVKSALHAMDYQEVTDVRIGKYMELQLE--STEKLEERVKEMCEKLLANTVIEDYRFEV. 77
29  7.000e-23 33  Rhodobacter sphaeroides 2.4.1 gi|46192728||ref|ZP_00006176.2| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..........MLKDGVLDPQGEAVKHALGTLGFSGVEGVRQGKVIELDLTATDRAEAEAEVRRMCEKLLANTVIEKYTVEI. 71
30  8.000e-23 30  Novosphingobium aromaticivorans DSM 12444 gi|48851163||ref|ZP_00305405.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 2 ....KVRVIVTLKNGVLDPQGRAIHHALEGLGFSGVNDVRAGRVIELDVADTTSDEA---LDEMCRKLLANMVIENYRIE.. 74
31  8.000e-23 25  Streptomyces coelicolor A3(2) gi|5918479||emb|CAB56357.1| hypothetical protein SCD25.13 [Streptomyces coelicol protmod 1 ..MARVVVDVMLKPEILDPQGQAVQRALPRLGFEGISDVRQGKRFELEVDGPVDDAALARIHDLAESFLANTVIEDFTVKV. 79
32  9.000e-23 28  Bacillus anthracis str. `Ames Ancestor` gi|47525555||ref|YP_016904.1| phosphoribosylformylglycinamidine synthase, purs p protmod 1 ..MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMELTIDKSVSDL-DAKVKEMCEKLLANVVMEDFRYEV. 78
33  1.000e-22 28  Bacillus cereus ATCC 14579 gi|30018535||ref|NP_830166.1| Phosphorybosylformylglycinamidine synthetase, PurS protmod 1 ..MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMELTIDKSVSDL-DSKVKEMCEKLLANVVMEDFRYEV. 78
34  1.000e-22 28  Bacillus cereus ATCC 10987 gi|42779402||ref|NP_976649.1| phosphoribosylformylglycinamidine synthase, PurS p protmod 1 ..MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMELTIDKSVTDL-DSKVKEMCEKLLANVVMEDFRYEV. 78
35  1.000e-22 26  Streptomyces avermitilis MA-4680 gi|29607795||dbj|BAC71852.1| putative phosphoribosylformylglycinamidine (FGAM) s protmod 1 ..MARVVVDVMLKPEILDPQGQAVQRALPRLGFEGVSDVRQGKRFELEVDGPVDDAALTRIRELAESFLANTVIEDFTVKV. 79
36  1.000e-22 31  Oceanobacillus iheyensis HTE831 gi|23098198||ref|NP_691664.1| hypothetical protein OB0743 [Oceanobacillus iheyen protmod 1 ..MKKVTVYITLKPGVLDPQGKAIQESLQSLGYQEVEDARVGKFIELQVEEG--PNIEERITEMCDRLLANPVIENYQFDL. 77
37  1.000e-22 26  Bacillus halodurans C-125 gi|10173241||dbj|BAB04346.1| BH0627 [Bacillus halodurans C-125] gi|15613190|ref| protmod 1 ..MYKVKVYVTLKESVLDPQGSAVQKSLHALSFTEVNEVRIGKYMELTLE-KGEGDLDERIHDMCQKLLANTVIEDYRYEV. 78
38  1.000e-22 32  Synechococcus sp. WH 8102 gi|33865328||ref|NP_896887.1| hypothetical protein SYNW0794 [Synechococcus sp. W protmod 3 VPRYQARVLVRLRPSVLDPAGEATRGAAERLGVEGISKLRIGKAVELEVEAPDAEEARRRLEVLSDRLLANPVIEDWSLEL. 83
39  2.000e-22 33  Silicibacter sp. TM1040 gi|52012004||ref|ZP_00339360.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 2 ....KARVHVMLKNGVLDPQGEAVRHALGALGFDKVEGVRQGKVIDLELA---EGATEADVTEMCEKLLANTVIESYSVEI. 75
40  3.000e-22 26  Lactobacillus plantarum WCFS1 gi|28379220||ref|NP_786112.1| conserved purine biosynthesis cluster protein [Lac protmod 1 ..MYLVKIYVTYKQSILDPKGEAIHDALHRLGYTNVDAVELGKYFEVKIHADDRPVA-AEIDEMCDRLLANVNMETYRYEI. 78
41  3.000e-22 27  Thermobifida fusca gi|48835268||ref|ZP_00292269.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MARVIVDVMLKPEILDPQGQAILGACERLGFSGVTQVRQGKRFEIDLEGEADEARLAEIRKLAETLLANPVIEDFSLRV. 79
42  4.000e-22 25  Chlorobium tepidum TLS gi|21674161||ref|NP_662226.1| hypothetical protein CT1339 [Chlorobium tepidum TL protmod 3 ...FKAKIKVTLRPSILDVQGKAAQHALENLGYSSVESIRIGKYIEVIIGEDFRAEAEQVCTEICQKLLSNPIMEDFSFEL. 80
43  4.000e-22 26  Zymomonas mobilis subsp. mobilis ZM4 gi|56544001||gb|AAV90155.1| phosphoribosylformylglycinamidine synthase small sub protmod 2 ....KANVHVTLKNGVLDPQGKAIHHALERLGFSGVNNVRVGRLIELDLDDNVSD---QEIEDMCRKLLANMVIESFRIE.. 74
44  5.000e-22 23  Enterococcus faecium gi|48825161||ref|ZP_00286445.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MYFVKVYVTYKDSVLDPQGEAVKKAVHRMGYETIEDIRIGKYFEIQL-ADAEEPIDTVIETICDKLLANVNMETYRYEI. 78
45  7.000e-22 25  Listeria innocua Clip11262 gi|16800949||ref|NP_471217.1| hypothetical protein lin1883 [Listeria innocua Cli protmod 1 ..MYNVKVYVTLKKSVLDPQGVAVKDAAKSMGYEEVEDVRIGKFMELKVAKSDRD-IHEVLNEMCDKLLTNPVMEDYRYEI. 78
46  9.000e-22 25  Enterococcus faecalis V583 gi|29376331||ref|NP_815485.1| phosphoribosylformylglycinamidine synthase, PurS p protmod 1 ..MYFVKVYVTYKESILDPQGEAVKEAVHRLGFTEVAEIRVGKYFEMHVQQT--EAIEEKIEQICDQLLANVNMESYRFEIL 78
47  1.000e-21 31  Wolinella succinogenes DSM 1740 gi|34557022||ref|NP_906837.1| MSL0067 PROTEIN [Wolinella succinogenes DSM 1740] protmod 3 .....AKITVSLKPGVLDPQAKAIGHALEVLGFEGIQETVVGKIITLKLAESDAIKAKESVTQMCETLLANTVIENYQIELL 79
48  2.000e-21 26  Oenococcus oeni PSU-1 gi|48865787||ref|ZP_00319645.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MFLAKIYVTYKPSILDPQGEVIKSALHRLDYTDVNSVMQGKYFEIKLEAKDQRTAAKEIEEFSDELLINVNMETFTYKL. 79
49  2.000e-21 25  Listeria monocytogenes str. 4b H7858 gi|47093697||ref|ZP_00231450.1| phosphoribosylformylglycinamidine synthase, PurS protmod 1 ..MYNVKVYVTLKKSVLDPQGVAVKDAAKSMGYEEVEDVRIGKFMELKVVKSDRD-IHEVLNEMCDKLLTNPVMEDYRYEI. 78
50  2.000e-21 25  Mycobacterium tuberculosis H37Rv gi|57116783||ref|YP_177755.1| hypothetical protein Rv0787A [Mycobacterium tuberc protmod 1 ..MARVVVHVMPKAEILDPQGQAIVGALGRLGHLGISDVRQGKRFELEVDDTVDDTT---LAEIAESLLANTVIEDWTI... 74
51  2.000e-21 30  Lactococcus lactis gi|4097531||gb|AAD12624.1| unknown [Lactococcus lactis] gi|11356450|pir||T51699 protmod 1 ..MTKVRVYVAYKASILDPQAQAIKAATHKMGYQEVSDLNVGKFFDFDFDAE-AELAKEKATEIANELLANPNMETYKVEIL 79
52  3.000e-21 25  Mycobacterium avium subsp. paratuberculosis str. k10 gi|41406723||ref|NP_959559.1| hypothetical protein MAP0625 [Mycobacterium avium protmod 1 ..MARVIVSVMPKAEILDPQGQAIVGALGRLGHSGISDVRQGKRFELEVDDSVDDAA---LAEIAETLLANTVIEDWTI... 74
53  3.000e-21 32  Silicibacter pomeroyi DSS-3 gi|56678501||gb|AAV95167.1| phosphoribosylformylglycinamidine synthase, PurS pro protmod 2 ....KARVHVMLKNGVLDPQGEAVRHALGAMGFDKVTGVRQGKVIDLDL---VEGATEADVAEMCEKLLANTVIERYEIEL. 75
54  4.000e-21 24  Mycobacterium leprae TN gi|15828191||ref|NP_302454.1| hypothetical protein ML2219A [Mycobacterium leprae protmod 1 ..MARAVVHVMLRAEILDPQGQAIAGALGRLGHTGISDVRQGKRFELEIDDTVDD---SELAMIAESLLANTVIEDWTI... 74
55  5.000e-21 24  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 gi|23024954||ref|ZP_00064140.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MYLAKIYVTYKPSILDPQGEVIKAALNRMDYSGIEQVSQGKYFEIKLKATDVDAATSEVESFTDALLINQNTETYRFDL. 79
56  5.000e-21 31  Deinococcus radiodurans R1 gi|6457895||gb|AAF09810.1| conserved hypothetical protein [Deinococcus radiodura protmod 1 MPHYQAKIYVTLRPSILDPQGRTVERALSHLNHDNVGSVRIGKYIELNLSGE-KADVEAQLKDIVENVLSNPIMEDARWEL. 80
57  6.000e-21 24  Methanosarcina mazei Go1 gi|21228908||ref|NP_634830.1| hypothetical protein MM2806 [Methanosarcina mazei protmod 3 ...YQATVTIEQKAGMLDPEGTTAKRALGHLGYA-VESVKTAKLYEIVLEAESAEVAKQKVDEMCQKLIANPIIHNYTIEL. 79
58  7.000e-21 31  uncultured archaeon GZfos26E7 gi|52549226||gb|AAU83075.1| phosphoribosylformylglycinamidine [uncultured archae protmod 2 ..RYCAEITIQLKQGMLDPEGETIQRALTHLGYA-VKSAHAAKRLLIELEADDADDATGMVDEMCRKMLANPVIHNYSI... 77
59  8.000e-21 31  uncultured archaeon GZfos18C8 gi|52548681||gb|AAU82530.1| phosphoribosylformylglycinamidine synthase I [uncult protmod 2 ..RYCAEITIQLKQGMLDPEGETIQRALTHLGYA-VKSAHAAKRLLIELEADDTDDATKMVDEMCRKMLANPVIHNYSI... 77
60  9.000e-21 32  Campylobacter lari RM2100 gi|57018099||gb|EAL54874.1| phosphoribosylformylglycinamidine synthase, PurS pro protmod 2 ....KVIVNITLKNGVLDPQGKVIEKALHSLDFNNIANVKTSKQISFDIACDNKEEALKQVDLMCKELLANTVIEDYEI... 76
61  1.000e-20 29  Bacillus subtilis gi|55669845||pdb|1T4A|B Chain B, Structure Of B. Subtilis Purs C2 Crystal Form g protmod 2 ...YKVKVYVSLKESVLDPQGSAVQHALHSXTYNEVQDVRIGKYXELTIEKSDRDL-DVLVKEXCEKLLANTVIEDYRYEV. 78
62  2.000e-20 30  Lactococcus lactis subsp. lactis Il1403 gi|15673514||ref|NP_267688.1| hypothetical protein L177031 [Lactococcus lactis s protmod 1 ..MTKVRVYVAYKASILDPQAQAIKAATHKMGYQEVTELNVGKFFDFEFDAE-AEIARAKAIEIANELLANPNMETYKVEIL 79
63  2.000e-20 29  Pediococcus pentosaceus ATCC 25745 gi|48870011||ref|ZP_00322743.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MDNAKIYVTYKESILDPQGEAIKTALHRLNYENVKAVTVGKYFEIKIE-DHGQNIEEQVRKMSDELLANINMETYRFEI. 78
64  3.000e-20 34  Methanopyrus kandleri AV19 gi|20094228||ref|NP_614075.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 4 ..LVTVEVRVSLKPKALDPEGETVKRALHRLGYEEVEDVRTAKIYRIELDINDEEEAVELVDEMCRRLLANPVVEDYEIEV. 82
65  3.000e-20 24  Methanosarcina acetivorans C2A gi|20090812||ref|NP_616887.1| hypothetical protein MA1964 [Methanosarcina acetiv protmod 8 ...YQATVTIEQKAGMLDPEGTTAKRALGHLGY-AVESVKTAKLYEIVLEAESAEVAEQKVDEMCQKLIANPIIHNYTIKL. 84
66  4.000e-20 30  Helicobacter hepaticus ATCC 51449 gi|32263172||gb|AAP78217.1| conserved hypothetical protein [Helicobacter hepatic protmod 2 ....KVKVLVSLKEGVLDPQAKAIAHALCAHGFESLQSVKLSKEIILDIQENNADKAYNLAQSMCENLLANVVIEDYSIEIL 79
67  5.000e-20 33  Synechococcus elongatus PCC 6301 gi|56750730||ref|YP_171431.1| hypothetical protein syc0721_c [Synechococcus elon protmod 1 ...............MLDPAGAAVQTGLQHLGYDSVEQIRIGKYIELSLQAETEAIAREQLDQMCDQLLANPVIENYRFEL. 66
68  6.000e-20 24  Methanococcoides burtonii DSM 6242 gi|41720101||ref|ZP_00148940.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 3 ...YRAEVTIERKSGMLDPEGTTIKRALEHLGYHT-NDIKTSKRYIIYLEGESPEMAKTKVDEMCQKLIANPMIHNYTIDL. 79
69  7.000e-20 25  Nocardia farcinica IFM 10152 gi|54022534||ref|YP_116776.1| hypothetical protein nfa5670 [Nocardia farcinica I protmod 1 ..MARVVVEVMPKAEILDPQGQAIVGALPRLGFAGISDVRQGKRFELDVDDSVSD---AELEQIAESLLANTVIEEWKV... 74
70  8.000e-20 25  Gluconobacter oxydans 621H gi|58040726||ref|YP_192690.1| Phosphoribosyformylglycinamidine synthase PurL [Gl protmod 2 ....KIRVFVSLKDGVLDPQGKAVGHALETLGFKGLGEVRINRVVELEVPADNAADALAQGEAMARALLANEVIEDFSVEV. 78
71  1.000e-19 37  Campylobacter upsaliensis RM3195 gi|57505857||ref|ZP_00371782.1| phosphoribosylformylglycinamidine synthase, PurS protmod 2 ....QVVVNVFLKNGVLDPQGKALEKALHSLNFSRVKEVRMAKQLKIELDESDTQKARELVAKMCEELLVNSVIEDYEI... 76
72  1.000e-19 31  Prochlorococcus marinus subsp. pastoris str. CCMP1986 gi|33861336||ref|NP_892897.1| hypothetical protein PMM0779 [Prochlorococcus mari protmod 1 MDQFEVKVFIRLRPSVLDPAGEAIKSASSKLGVAGIKSLRIGKLIEVKIE-SNEEDIKEKIELLCDRLFANTVIEDYEYSI. 80
73  2.000e-19 24  Methanosarcina barkeri str. fusaro gi|48838776||ref|ZP_00295715.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 3 ...YQATVRIEQKAGMLDPEGTTAKRALGQLGYQ-VSNVKTAKLYEIVLEAESVEIANQKVDEMCQKLIANPIIHNYTIDL. 79
74  2.000e-19 40  Campylobacter coli RM2228 gi|57167561||ref|ZP_00366701.1| phosphoribosylformylglycinamidine synthase, PurS protmod 2 ....KILVNVFLKNGVLDPQGKAIEKALHSLNFNEIKEARVAKQIVLDLDESDEQKAKERVKSMCEELLVNSVIEDYEL... 76
75  2.000e-19 32  Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 gi|45656578||ref|YP_000664.1| hypothetical protein LIC10680 [Leptospira interrog protmod 1 ..MYIAKIQVVLKESVLDPQGSTVKKVLSEVGEKSVQDVRVGKYIELKIDAPSEEVARKDVERLCDKILVNHIIETYSMNI. 79
76  3.000e-19 29  Pyrococcus horikoshii OT3 gi|18656947||ref|NP_570868.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 3 ...WKVRVLVRLKEGLNDPEGRVIGNALKNLGYK-VEDLRVPKCFEFILESDNPEK---DVEEMCKRLLANPLIHTWEYTI. 76
77  3.000e-19 31  Unknown gi|58337821||ref|YP_194406.1| putative phosphoribosylformylglycinamidine (FGAM) protmod 1 ..MTTIRIYVTYKPSVFDPQGAAITNSVNSLGHDEVKKIVVGKFFDVTVDEDDLDKVKADVKDIAESLLVNFNMETYKIKVL 80
78  4.000e-19 23  Halobacterium salinarum NRC-1 gi|15790825||ref|NP_280649.1| hypothetical protein VNG1944C [Halobacterium salin protmod 1 MTAYTATVTVRLQHGVLDPEAETTQQALERLGFE-LDALRSADRFEIDLDADDEQAAAERADEMAHRLLANPTIHDYDV... 78
79  5.000e-19 31  Corynebacterium glutamicum ATCC 13032 gi|21325362||dbj|BAB99983.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 1 ..MARVVVNVMPKAEILDPQGQAVHRALGRIGVSGVSDVRQGKRFELEVDDSVTE---ADLKKIAETLLANTVIEDFDV... 74
80  6.000e-19 28  Corynebacterium efficiens YS-314 gi|23494325||dbj|BAC19292.1| conserved hypothetical protein [Corynebacterium eff protmod 1 ..MARVVVNVMPKAEILDPQGQAVHRALGRIGVTGVSDVRQGKRFELEVDDSV---STADLEKIAETLLANTVIEDFDV... 74
81  7.000e-19 29  Pyrococcus furiosus DSM 3638 gi|18976569||ref|NP_577926.1| hypothetical protein PF0197 [Pyrococcus furiosus D protmod 2 ..RWRVRVLVRLKEGLNDPEGRVIGNALRNLGY-RVEELRVPKCFEFILESDNPEK---DVEEMCRRLLANPLIHTWEYTI. 76
82  7.000e-19 31  Corynebacterium glutamicum gi|57157721||dbj|BAD83828.1| hypothetical protein [Corynebacterium glutamicum] protmod 1 ..MARVVVNVMPKAEILDPQGQAVHRALGRIGVSGVSDVRQGKRFELEVDDSVTET---DLKKIAETLLANTVIEDFDV... 74
83  1.000e-18 29  Corynebacterium ammoniagenes gi|6705962||dbj|BAA89449.1| PurORF [Corynebacterium ammoniagenes] protmod 1 ..MARVVVNVMPKAEILDPQGQAVVRALGRLGVNGVSDVRQGKRFEIEVDDSVSA---EDLDKVAASLLANTVIEDYEV... 74
84  1.000e-18 26  Staphylococcus aureus subsp. aureus MSSA476 gi|49244349||emb|CAG42777.1| conserved hypothetical protein [Staphylococcus aure protmod 1 ..MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVL 80
85  2.000e-18 29  Tropheryma whipplei str. Twist gi|28476805||gb|AAO44893.1| unknown [Tropheryma whipplei str. Twist] gi|28493763 protmod 52 ..IVKIIIDVMPKPGLLDPQGRAIASVLTERGWDNSTRIRVGKRFELCVDPVSETCELDFIRDLANDLLINPVIED...... 125
86  2.000e-18 35  Campylobacter jejuni RM1221 gi|57238284||ref|YP_178635.1| phosphoribosylformylglycinamidine synthase, purS p protmod 3 .....VIVNISLKNGVLDPQGKAVEKALHSLNFNSVKEVKIAKQIKISLDEKDEKLAKEQVKKMCEELLVNSVIEDYEL... 76
87  2.000e-18 26  Staphylococcus aureus subsp. aureus MRSA252 gi|49483231||ref|YP_040455.1| hypothetical protein SAR1041 [Staphylococcus aureu protmod 1 ..MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVL 80
88  2.000e-18 32  Rhodopseudomonas palustris CGA009 gi|39936881||ref|NP_949157.1| Protein of unknown function UPF0062 [Rhodopseudomo protmod 2 ....KARVTVTLKNGILDPQGKAIEGALKSLGVAGIASVRQGKVFDIELDGADKAKAEAALKDAADKLLANTVIENYRVEVL 80
89  3.000e-18 29  Kineococcus radiotolerans SRS30216 gi|46102873||ref|ZP_00197960.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MGRVVIDVMPKPEILDPQGKAVVGALPRLGFDLFTSVRQGKRFELEVAGEVTPEVLAQARRAAETLLSNPVIED...... 74
90  4.000e-18 30  Exiguobacterium sp. 255-15 gi|45531500||ref|ZP_00182544.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 1 ..MKKVTVAVALRESILDPQGVAVKGGLVQLGFAGVEEVRIGKRIELLVADETTD---AMIHEMCQKLLVNTVMEDYRFDV. 76
91  7.000e-18 32  Bradyrhizobium japonicum USDA 110 gi|27380839||ref|NP_772368.1| hypothetical protein bsl5728 [Bradyrhizobium japon protmod 2 ....KARVTVTLKTGILDPQGKAIEGALKSLGVAGVASVRQGKVFDIELAGADKAKAEAALKEAADKLLANTVIENYRVEI. 78
92  1.000e-17 34  Methanocaldococcus jannaschii DSM 2661 gi|15669788||ref|NP_248602.1| hypothetical protein MJ1593 [Methanocaldococcus ja protmod 1 ..MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEGENEEKVKEEVEEMCKKLLANPVIHDYEIKV. 79
93  1.000e-17 24  Propionibacterium acnes KPA171202 gi|50843435||ref|YP_056662.1| phosphoribosylaminoimidazole-succinocarboxamide sy protmod 344 ..MSRVVVEVMPKPEILDPQGKAITSVLARLGHDGLT-VRQGKRFEITGEG--LEDRLDEIRQVASGLLANTVIESFDV... 417
94  2.000e-17 32  Rubrobacter xylanophilus DSM 9941 gi|46106441||ref|ZP_00199988.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 2 ....RVRVLVRPKRGILDPQGEAVRSALPALGFEGVRSVRVGRLIELELE------SEAEVEAMCRRLLANPTTEEYEWEV. 72
95  2.000e-17 22  Staphylococcus epidermidis ATCC 12228 gi|27467683||ref|NP_764320.1| hypothetical protein SE0765 [Staphylococcus epider protmod 1 ..MKTIELHITLQPQVLDTQGQALNRAVHDLGYEQVNDIRVGKVLYMTVNEPTDEAVDNIITTLSEKLFANTVIEEYSYKVI 80
96  4.000e-17 98  Thermotoga maritima MSB8 gi|15644000||ref|NP_229049.1| hypothetical protein TM1244 [Thermotoga maritima M protmod 1 MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVKKACEELLVNPVVEEYEVREL 82
97  6.000e-17 28  uncultured Acidobacteria bacterium gi|31789479||gb|AAP58592.1| putative phosphoribosylformylglycinamidine synthase protmod 2 ....RARVFVTLKPSVFDPQGTIVAEALHTLGYPAVSGVRQGKYFELDIDVPTAEEAERVAADAAAKLLANPVIESYRVEV. 78
98  1.000e-16 32  Thermus thermophilus HB27 gi|46199454||ref|YP_005121.1| hypothetical cytosolic protein [Thermus thermophil protmod 1 MPRYQATLLIELKKGILDPQGRAVEGVLKDLGH-PVEEVRVGKVLEIVFPAENLLEAEEKAKAMG-ALLANPVMEVYALEAL 80
99  3.000e-16 24  Methanothermobacter thermautotrophicus str. Delta H gi|15678197||ref|NP_275312.1| hypothetical protein MTH169 [Methanothermobacter t protmod 3 ...FMVEVRIRLKKGMLNPEAATIERALALLGYE-VEDTDTTDVITFTMDEDSLEAVEREVEDMCQRLLCNPVIHDYDVSI. 79
100  5.000e-16 20  Leifsonia xyli subsp. xyli str. CTCB07 gi|50955775||ref|YP_063063.1| phosphoribosylformylglycinamidine synthase [Leifso protmod 1 ..MSTIVVEVMPKAELLDPQGKAVAGALSRTGKGAFSSVRVGKRFELTVDGPIDGTTRAAVEEIANDILSNSVIED...... 74
101  6.000e-16 30  Tropheryma whipplei TW08/27 gi|28572947||ref|NP_789727.1| hypothetical protein TW806 [Tropheryma whipplei TW protmod 2 ....KIIIDVMPKPGLLDPQGRAIASVLTERGWDNSTRIRVGKRFELCVDPVSETCELDFIRDLANDLLINPVIED...... 73
102  1.000e-15 22  Thermoplasma acidophilum gi|10640358||emb|CAC12172.1| conserved hypothetical protein [Thermoplasma acidop protmod 6 ..IMKFRVEIRYKEGVEDPEAVTILKNFNILGYKGIRDVRTSKVYYIDADDRDE------VSEITSKILANPVIHTYTIE.. 77
103  2.000e-15 24  Methanothermobacter thermautotrophicus gi|27573602||pdb|1GTD|B Chain B, Northeast Structural Genomics Consortium (Nesg protmod 3 ...FXVEVRIRLKKGXLNPEAATIERALALLGYE-VEDTDTTDVITFTXDEDSLEAVEREVEDXCQRLLCNPVIHDYDVSI. 79
104  2.000e-15 31  Archaeoglobus fulgidus DSM 4304 gi|11499525||ref|NP_070766.1| hypothetical protein AF1941 [Archaeoglobus fulgidu protmod 3 .....ADVYIELKEGVADPEGEATLKALRLLGFKRVKKVSTVKVFRIDIEARSREEAEREIAEMCEKLLANPVIQKYSI... 76
105  2.000e-15 22  Thermoplasma acidophilum DSM 1728 gi|16082584||ref|NP_394504.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 2 ....KFRVEIRYKEGVEDPEAVTILKNFNILGYKGIRDVRTSKVYYIDADDRDE------VSEITSKILANPVIHTYTIE.. 71
106  4.000e-15 28  Thermococcus kodakaraensis KOD1 gi|57158461||dbj|BAD84391.1| phosphoribosylformylglycinamidine synthase, PurS co protmod 3 ...WKVKVIVRLKEGLNDPEGRVIGNALKNLGF-SVENLRVPKYFEF---ELESERPEEEVEEMCRKLLANPLIHEWEYSI. 76
107  1.000e-14 26  Pyrococcus abyssi gi|5459163||emb|CAB50649.1| purS phosphoribosylformylglycinamidine (FGAM) syntha protmod 2 ..RWKVRVLVRLKEGLNDPEGRVIGKALKNLGYK-VEELKVPKCFEFVL---ESEKPEEEVEEMCRRLLANPLIHTWEYTI. 76
108  2.000e-14 26  Pyrococcus abyssi GE5 gi|33356827||ref|NP_127420.2| hypothetical protein PAB3433 [Pyrococcus abyssi GE protmod 6 ..RWKVRVLVRLKEGLNDPEGRVIGKALKNLGYK-VEELKVPKCFEFVL---ESEKPEEEVEEMCRRLLANPLIHTWEYTI. 80
109  3.000e-14 27  Thermoplasma volcanium GSS1 gi|13541382||ref|NP_111070.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 2 ....KFKVEVSYKPGVEDPEALTLLKNLNILGYHEISNVSISKVYYFD------AGNEEEVKQVADKILSNPVIHSYKVEKL 73
110  1.000e-13 28  Picrophilus torridus DSM 9790 gi|48478276||ref|YP_023982.1| phosphoribosylformylglycinamidine synthase, PurS c protmod 2 ....KAKIEVTYLPNVEDPEALSIEKNLSMLGYNGIKGLSIKKIYEFTLDDDS----YNVLDEIAGRILTNPVIQSYKI... 72
111  1.000e-13 31  Aquifex aeolicus VF5 gi|15607138||ref|NP_213637.1| Phosphoribosylformylglycinamidine (FGAM) synthase, protmod 1 ..MKLVRVIIMPKEGLLDPQGRAVEEMLKENGF-NVSNVRVGKVVELEVSEDTD------LRKLVEKYLINPLIEDYEIEEL 73
112  7.000e-13 27  Haloarcula marismortui ATCC 43049 gi|55379821||ref|YP_137671.1| hypothetical protein rrnAC3269 [Haloarcula marismo protmod 1 MTAFTATVTVRLKRGVLDPEAETTQRSLERLGFD-LNDLRSADVFELDLDADSADDAAERAEEMAERLLANPTIHDYDVEV. 80
113  9.000e-13 33  Sulfolobus tokodaii str. 7 gi|15921787||ref|NP_377456.1| hypothetical protein STS178 [Sulfolobus tokodaii s protmod 5 ..LYRVELIITNKEGVRDPEGETIQRYVVSRFSDKIIETRAGKYLVFRVNSSSQQEATELVKKLADEMLYNPIVHKIEIR.. 83
114  1.000e-12 28  Ferroplasma acidarmanus gi|48852581||ref|ZP_00306766.1| COG1828: Phosphoribosylformylglycinamidine (FGAM protmod 2 ....KVKVQIKYLPNVEDPEALSIKRNLELIGYEGIKNIYSYKIYEFE-TSLDREDSISEIREIAEKLLTNPVIQEYKIE.. 76
115  2.000e-12 28  Geobacter metallireducens GS-15 gi|48846099||ref|ZP_00300366.1| COG0046: Phosphoribosylformylglycinamidine (FGAM protmod 4 ......RIEIALKEGVRDARGERIKREIEHFLHLPVEAVRT-----IDVYTVDAKLSEEELVKAASEPFCDPVIQVWSID.. 72
116  3.000e-12 27  Geobacter sulfurreducens PCA gi|39996734||ref|NP_952685.1| phosphoribosylformylglycinamidine synthase II, put protmod 4 ......RIEVALKEGVRDARGERVRREIEHFLHLPVHEVRT-----IDVYTVDAGLSPDELEKAASEPFSDPVIQTWSLD.. 72
117  2.000e-11 32  Sulfolobus solfataricus P2 gi|15897543||ref|NP_342148.1| hypothetical protein SSO6264 [Sulfolobus solfatari protmod 3 ...YYVELIIINKDSVRDPEGETIQKYVIEKYTNNIIETRVGKYIQFKIEANNEEDAKNLIEKIANERLYNPIIHKILVRV. 81
118  3.000e-10 34  Pyrobaculum aerophilum str. IM2 gi|18311792||ref|NP_558459.1| hypothetical protein PAE0224 [Pyrobaculum aerophil protmod 3 ...YAVYLNVTYKPSIRDPEGETISKDLGRLGYS--VEVRAGKCLVLVIDAQSEEAASNALKIAKEARLGNPNVHVVEV... 78
119  8.000e-10 30  Dehalococcoides ethenogenes 195 gi|57234830||ref|YP_181125.1| phosphoribosylformylglycinamidine synthase II [Deh protmod 85 .......IEVTYNAGVTDPVQETILKAISDLGIKGVTAAKTAKRYLLKGEISADE-----LDTIGSKLLINPIVQ....... 147
120  7.000e-09 18  Rhodopirellula baltica SH 1 gi|32473676||ref|NP_866670.1| phosphoribosylformylglycinamidine synthase II [Rho protmod 109 .......VHVMPKPGVMDPVAASTQGALADRGVEGVKTFR-----KFWIAGTDE----AQLETICRRALSNDSIEAFVI... 173
121  2.000e-06 23  Dehalococcoides ethenogenes 195 gi|57234830||ref|YP_181125.1| phosphoribosylformylglycinamidine synthase II [Deh protmod 3 ......RIEVSLKPEWPDPKGNSICRDIQDLGITSVSEVRVIDVFWLEGQLSDSE-----VLTISGELLSDKIIQTFKYD.. 71



Contact us