Homologs of:

1j5s_A mol:protein length:463 Uronate Isomerase
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450
# E-value %id Organism Protein Model Start MFLGEDYLLTNRAAVRLFNEVKDLPIVDPHNHLDAKDIVENKPWNDIWEVEGATDHYVWELMRRCGVSEEYITGSRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIKKVISEETAEEIWEETKKKLPEMTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEAVEGVTILPTWRPDRAMNVDKEGWREYVEKMGERYGEDTSTLDGFLNALWKSHEHFKEHGCVASDHALLEPSVYYVDENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHIGALRDYRDSLFKTLGPDSGGDISTNFLRIAEGLRYFLNEFDGKLKIVLYVLDPTHLPTISTIARAFPNVYVGAPWWFNDSPFGMEMHLKYLASVDLLYNLAGMVTDSRKLLSFGSRTEMFRRVLSNVVGEMVEKGQIPIKEARELVKHVSYDGPKALFFGEnd
0.000e+00 20  Rhodopirellula baltica SH 1 gi|32474066||ref|NP_867060.1| hypothetical protein RB6095 [Rhodopirellula baltic protmod 19 ...............EIYEALTSIRLIDPHSHINPHSPAS----TTLADVLGY--HYYTELAHSAGMPKSQIEDKAIGPK------ELVERLVGTAQYSWLIEICRTFFGFEERLHLNNWEALYDRSESIMA--SAQTVLDQSNVQAVFLTNDFDDALE--------GFDTETIPCLRTDDLVKPEVRG------RLAACTGIELGSLESLRSSLKQRFEHFVSRGARACAISIPPTFTTPVGDGRASTALNAVLQGISADASHRDALARRVFWTLAELCDEFGLPFDLMIGVNRQYPEGVFQ--GQDL-YDSRVSLIQYRE----LFNSF-PNVKFPVSVLASVTNQELVSYAWIFPNVITNGHWWYSNTPSFIARRLEAVPQT----KQIGYYSDAYKLEFIWPKFDMYRKVLSGVLAQFVCDRGWSVERAVELGRKVLRDNVEEIF.. 437
0.000e+00 28  Corynebacterium glutamicum ATCC 13032 gi|19553683||ref|NP_601685.1| putative uronate isomerase [Corynebacterium glutam protmod 15 ...HPDRLLTRDIARRLLAHVEDLPIISPHGHLEASMFVKDEAFPDPTSLLISPDHYLTRMMHSAGVDLADLRVGKSAREAWRIFMSHWDLYAGTATGYWVEQEFEHVFGINERLNPEHADAIFDELTDILPDFRPRALAEQFNLEVLATTDDPLDDLADHKALADDTFSPRVLPTFRPDAYTKMYNAGWAEKTTKLIDTAGDGKAGWEGYLQAMRNRRQYFINHGATSADHGLHDTDTTPLSHKDAQKILDKGLAG-TATLAEMHAFEANTTYRFAEMSQEDGLVMTIHPGVYRNHSASAQKKFGADIGADIPF-QMEFTNGLRPLLSDFGENKDLIS---DSSFNR....................................................................................................... 370
0.000e+00 28  Corynebacterium glutamicum gi|32699747||sp|Q8NMT1|UXAC_CORGL Uronate isomerase (Glucuronate isomerase) (Uro protmod 8 ...HPDRLLTRDIARRLLAHVEDLPIISPHGHLEASMFVKDEAFPDPTSLLISPDHYLTRMMHSAGVDLADLRVGKSAREAWRIFMSHWDLYAGTATGYWVEQEFEHVFGINERLNPEHADAIFDELTDILPDFRPRALAEQFNLEVLATTDDPLDDLADHKALADDTFSPRVLPTFRPDAYTKMYNAGWAEKTTKLIDTAGDGKAGWEGYLQAMRNRRQYFINHGATSADHGLHDTDTTPLSHKDAQKILDKGLAG-TATLAEMHAFEANTTYRFAEMSQEDGLVMTIHPGVYRNHSASAQKKFGADIGADIPF-QMEFTNGLRPLLSDFGENKDLIS---DSSFNR....................................................................................................... 363
0.000e+00 26  Leifsonia xyli subsp. xyli str. CTCB07 gi|50955310||ref|YP_062598.1| glucuronate isomerase [Leifsonia xyli subsp. xyli protmod 97 ..............................GHL-----ADDEPFPDPAALLITPDHYVTRTLHSLGVPLRALGSPASGRAIWRTLCENWEAFLGTPVRFWFESEFSEVFGLTEHPSAANADALYDQLAEMIPAFRPRALFDRFRIAVLATTDDPADDLEAHRLAADPGFTGRVVPTFRADRYMHPDEPGRAGRLDRLAAASGTDTGSYAGLLAALRARRAAFAAAGGTATDTGVIDAGSEPLTKTAAERIHRSALAG-ALDPADAVAYRRNLLYRLAEMSAEDGLVMQLHPGVHRNHHRPTFDQYGPDTGHDLH-AVTAFTEPLTPILRDFNPTFRLVLFTVDETFSREIAPLAGFYPSVYAGAPWWFLDTPAAILRYRRAITDSAGVAKTSGFIDDTRAFCSIPTRHDMSRRVDAAFLASLVVSHQL....................... 500
0.000e+00 26  Brucella melitensis 16M gi|17988821||ref|NP_541454.1| URONATE ISOMERASE [Brucella melitensis 16M] gi|179 protmod 1 MALNPDRLFTREIARRLFASVEKLPIISPHGHTEPIWYARNEAFPDPASLFVKPDHYITRMLYSQGHSLESLGIASRDRKIWRLFATNWYLFRATPSRLWFEHAMETVFGITERLSQENADRIFDAIADQLPHMRPRALYDRFNIEAISTTDAATDPLIYHDEVIASGWHGRIIPAYRPDAAVDAGRPDFASEVEKLVGVAGTPL-TWQGYLDAHRNRREYFKRRGATSSDHGHPTAQTADLSAGDASRLFDRVIKGNAST-SDAEMFRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIP-RQTGFVDQLKPLLDAFDPRLTVILFTLDETA......................................................................................................... 360
0.000e+00 28  Nostoc punctiforme PCC 73102 gi|53686631||ref|ZP_00105730.2| COG1904: Glucuronate isomerase [Nostoc punctifor protmod 2 ....................................................................................FAEHFYLFQGTPSGLWLKDELTNVFGVDEALNSRNAGRIYDEGLLALPKFSPRALFKRFNIEVLCTTDAASDNLENQRSLHEEGFT-QIRPTFRPDAVVNLDAPGWRENLTKLESSIGREISSYATFVQALEERRAFFKKMGATATDQGAATPYTTSLSDQEAEAIFARALIGK-LNPGDVEQFTGHIFMEMARMSVEDGLVMQMHCGVMRNHNPALFERFGSDKGADIPLN-IEWTRNLHPLLSSYNQRFRLIIFGMDETYSREMAPLAGHYPTILLGPPWWFHDSVNGMERYFNQVMETAGIYNTAGFNDDTRAFVSIPARHNVWRRVACNWLAGLVTRGLVDEEEGYDMARALAYDLAKSAY.. 368
0.000e+00 37  Escherichia coli gi|606033||gb|AAA57896.1| ORF_f352 [Escherichia coli] protmod 25 .FMTEDFLLDTEFARRLYHYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPSTADEIWNECNELLAQFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDS.......................................................................................................................................... 341
0.000e+00 27  Propionibacterium acnes KPA171202 gi|50843764||ref|YP_056991.1| uronate isomerase [Propionibacterium acnes KPA1712 protmod 8 ..LSEDRLLPREAAREIYRSTKGLPIISPHGHVPVSWIADDMAFSDPTSLLITPDHYVNRLLHANGVDLEDLGVGRDNRRAFRILCEHWRDFAGTAMRYWLVDQLIGIFGITERPSPENADRIYDTIAERIPDFLPRALMDSFDIAFIATTDDPCDDLDGHRLAADETFTRRVAPTFRPDKYLEPAAGGWTGLLARLSEVSGCDATTLDGFTEAMEDRRAYFRQHGAVSSDHSHRDLGTIILDHDRAASIFDASVAG-RATVEEMALLRRHLFTDQARMASEDGLTMTVHPAVHRNHDTAAFHRFGADIGSDVPVT-LEVVDSLHPLLDKFNTDLKLVVFTIDETYSREIAPLSGWYRSLYIGVPWWFIDAPESVMRFKHAVTEMAGFSRVSGMIDDTRAFCSIPARHDMSRRLDAAHLAELVVLGRLDLDEAVEIAHRLVVEQPTQVF.. 468
0.000e+00 28  Corynebacterium efficiens gi|32699745||sp|Q8FMX2|UXAC_COREF Uronate isomerase (Glucuronate isomerase) (Uro protmod 8 ...HPDRLLTRDIARRLLTYVEDLPIISPHGHLEASMFVKDEPFADPTTLLISPDHYLTRVLHSAGVDLADLTEGKTPREAWRIFASNWDLYTGTATGYWVEQEFEHVFGINDRLSAENADDIYDELSEILPDFRPRALAEQFNLEILATTDDPLDDLADHKALADPTFSPRVLPTFRPDAYTKMYNPGWAEKTTRLIDVAGDGKAGWEGYLQAMRNRRQYFIDHGATSADHGTHDTDTTPLSHEDAQRILDKGLAG-TATLAEMRAFEANTTYRFAEMCQDDGLVMTLHPGVYRNHSASAQKKFGNDIGADIPF-QLEYTRGLRPLLSDFNKDFHFVMFTIDETFSREVAPLAGYYPAAYVGAPWWFIDEIDAMNRFRSLTTGTTGFSRYSGFIDDTRAYCSIPARHNTSRRVEANYLARLVAEHRISETRASEIIVDLIDASPRRVF.. 467
10  0.000e+00 28  Corynebacterium efficiens YS-314 gi|23494220||dbj|BAC19187.1| putative uronate isomerase [Corynebacterium efficie protmod 20 ...HPDRLLTRDIARRLLTYVEDLPIISPHGHLEASMFVKDEPFADPTTLLISPDHYLTRVLHSAGVDLADLTEGKTPREAWRIFASNWDLYTGTATGYWVEQEFEHVFGINDRLSAENADDIYDELSEILPDFRPRALAEQFNLEILATTDDPLDDLADHKALADPTFSPRVLPTFRPDAYTKMYNPGWAEKTTRLIDVAGDGKAGWEGYLQAMRNRRQYFIDHGATSADHGTHDTDTTPLSHEDAQRILDKGLAG-TATLAEMRAFEANTTYRFAEMCQDDGLVMTLHPGVYRNHSASAQKKFGNDIGADIPF-QLEYTRGLRPLLSDFNKDFHFVMFTIDETFSREVAPLAGYYPAAYVGAPWWFIDEIDAMNRFRSLTTGTTGFSRYSGFIDDTRAYCSIPARHNTSRRVEANYLARLVAEHRISETRASEIIVDLIDASPRRVF.. 479
11  0.000e+00 34  Photobacterium profundum SS9 gi|54303188||ref|YP_133181.1| Hypothetical uronate isomerase [Photobacterium pro protmod 1 .............................................................MRTNGVNERFCTGNASDKDKFTEWAKTVSQTIGNPLFHWTHLELRRPFGITDRLSLETADSIWNECNAMLPEYSAQSLMKKMNVRMIGTTDDPIDDLSAHKSIANKDFNVKVLPSWRPDRSFNINASDYAHYLEQLGDAADVYIIKYNQLCDALINRLDHFQSHGCCISDHALDTVEYEESTEGELDAILALRLQGKTVSMKQAAQFKTAVLILLGKEYARRGWVQQYHIGALRNNNQRMLSILGPDTGFD-SINDGLIAAPLAKLLNALDALPKTILYCLNPRDNEVIATMCGNFQKIQFGSGWWFNDQKDGMVRQMEQLSQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRLLCRLLGQWVADGEVPHDLLSKMVEDICFNNANNYF.. 401
12  0.000e+00 27  Nostoc punctiforme gi|8572243||gb|AAF77061.1| putative hexuronic acid isomerase HrmI [Nostoc puncti protmod 8 ..LSPDRCFQRRLAHQFFDSISALPLVCPHGHVDPALLANPARFGSPTELFIIPDHYILRMLYSRGVPLEALGIPTRDRKIWQLFAEHFYLFQGTPSGLWLKDELTNVFGVDEALNSRNAGRIYDEGLLALPKFSPRALFKRFNIEVLCTTDAASDNLENQRSLHEEGFT-QIRPTFRPDAVVNLDAPGWRENLTKLESSIGREISSYATFVQALEERRAFFKKMGATATDQGAATPYTTSLSDQEAEAIFARALIGK-LNPGDVEQFTGHIFMEMARMSVEDGLVMQMHCGVMRNHNPALFERFGSDKGADIPLN-IEWTRNLHPLLSSYNQRFRLIIFGMDETYSREMAPLAGHYPTILLGPPWWFHDSVNGMERYFNQVMETAGIYNTAGFNDDTRAFVSIPARHNVWRRVACNWLAGLVTRGLVDEEEGYDMARALAYDLAKSAY.. 469
13  0.000e+00 35  Silicibacter sp. TM1040 gi|52009065||ref|ZP_00336431.1| COG1904: Glucuronate isomerase [Silicibacter sp. protmod 4 .FLHQDFLLDTATARRLFHEARYLPIVDYHNHLPPAEIASDRTWENLGEMWLAHDHYKWRVMRWAGIDEARVTGDATWREKFDAFAEAMPRAVLNPVHHWSHLELWRYFDLNTVLSPISADNVWDAANAQLGEYSAQSLLRKMKVELVGTTDDPLDTLEHHAAMA--GSDIRVVPTFRPDKSVQIEAPGFAAYMDSLEALT-HPIHSFDDLVAALSLRLDYFVEQGCRAADHGISHLDAANIPGADLDAALKAARQGKPITPEQVAGHRAALFDALGRAYAVRGLVMQCHMNVVRNGSSRLLLGVGPDAGGD-SMRDTDMAGPLNILLDRLDRLPRMVLYGLDPSRNPILAATAGTFQKIQAGAAWWFNDTLDGMEAQMRTLAQVGLLSTFLGMLTDSRSFLSFP-RHEYFRRLLCGMIGRWAETGHLPDDLLDRLVRDICYNNAKAWF.. 462
14  0.000e+00 27  Mesorhizobium sp. BNC1 gi|45914380||ref|ZP_00196664.1| COG1904: Glucuronate isomerase [Mesorhizobium sp protmod 1 ................MYEAVRDLPIISPHGHTDPRWFAENAAFADPARLVVVPDHYVLRMLCSQGIPLSDLGIPADPRTIWRRFAAHYHLFRGTPSQLWLDHSFENVFGLDERLNAATADAYFDHIASCLPEFRPRALYERFGIEAIATTDSPLDDLRWHDSIAESGWQGRVVCTYRPDAVIDPEGPGFAENLRQFGVVTGCDTSDWDGYLAAHRTRRADFRRRGATATDHGHPSARTENLDHAAAARLFARIRSGE-ATAEEADAFRGQMLTEMARMSLEDGLVMQIHPGSWRNHSGAVMAAFGPDRGFDIPTR-TDYVGALKPLLDAMEPNLTVILFNLDESAGRELAPLAGAYPALRLGPPWWFFDSAEGMRRFREAATETAGFYNTVGFNDDTRAFCSIPARHDVARRVDCGYLADLVCTGRLAEAEAAEVAYDLSYRLAKETY.. 444
15  0.000e+00 32  Streptococcus suis 89/1591 gi|50591258||ref|ZP_00332577.1| COG1904: Glucuronate isomerase [Streptococcus su protmod 1 .......MLKNEPAKELYGKIAELPIYDFHCHLDPKEIFEDKVYEDIVDLWLGGDHYKWRLMRANGISEEEITGSASKLDKFKAWARTLERAFGNPLYHWSHLELRQVFGVEELLTEENAERLYHQLNAYLQEVSPRKLIADARVTFIGTTDHPLDSLEWHKRLADSTIDTVVAPTFRPDEAF-IEHRNFNLFMKRLEEVTGVAVRDFASFVEALGQRVSYFAQHGCRASDISFTAISYEEATLEELDEILLARLAGKEAGQSSINKWQTAIFRELCRLYKKHGFVTQVHFGALRNNHTGLFEKLGADVGVDSIGDQTCLTVNLNRLLDNLNALPKMIWYNLNPSYNIALANTLANFQSLQFGAGWWFNDTKLGMIDQMNAYAEQGMLANFVGMLTDSRSFLSY-QRHDYFRRILATYVGQWIVDEEVPEDRLGQFVEAISYYNAKEFF.. 456
16  0.000e+00 27  Caulobacter crescentus CB15 gi|16125737||ref|NP_420301.1| hypothetical protein CC1490 [Caulobacter crescentu protmod 8 ...HEDRLFPSDPATRLYALVKDLPIISPHGHTDPSWFATNAPFQDATDLLLAPDHYLFRMLYSQGVSLDALKVDTDPREAWRVFASHFYLFRGTPSWVWLNHVFSQVFGFTEFLEASNADDYFDRITAALAAFRPRALFDRFNIETLATTEGPHESLQHHAAIRESGWGGHVITAYRPDAVIDFEDERSPRAFERFAETSGQDVYSWKSYLEAHRLRRQAFIDAGATSSDHGHPTAATADLSDVEAEALFNSLVKGD-VTPEKAELFRAQMLTEMAKMSLDDGLVMQIHPGSHRNHNVGLLNSHGRDKGADIPMR-TEYVDALKPLLTRLDPRLSIILFTLDETYSRELAPLAGHYPVLKLGPSWWFHDSPEGMMRFREQVTETAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLARMVAEHRMDLVEAEELIVDLTYNLPKKAY.. 468
17  0.000e+00 32  Streptococcus agalactiae NEM316 gi|25010729||ref|NP_735124.1| hypothetical protein gbs0674 [Streptococcus agalac protmod 3 .FNTETFMLKNQAAIQLYEEVKRQPIFDYHCHLDPKDIFEDRIFDNIVDLWLGGDHYKWRLMRANGISEAEITGPASNLEKFKAFARTLERAYGNPVYHWSAMELKNVFGVNEILTESNAEEIYHRLNHFLKEISPRRLIADSKVMFIGTTDYPLDTLKWHKKLADESFKTVVAPTFRPDEAF-IEHRHFVDFITKLGDITQKEITDFSTFIAAMEERIAYFAQNGCRASDISFTEIVFEQTDELELNDLFNKVCEGYIPNQSEISKWQTAVFMELCRLYKKYGFVTQVHFGALRNNHSTIFEKLGADVGVDSLGDQVALTVNMNRLLDSLDSLPKMIWYNLNPAYNIAVANTLANFQALQFGAGWWFADTKLGMISQMNALAEQGMLANFIGMLTDSRSFLSY-QRHDYFRRILCTYLGEWIEEGEVPEDYLGSMAKDIAYQNAVNYF.. 464
18  0.000e+00 33  Streptococcus agalactiae 2603V/R gi|22536865||ref|NP_687716.1| glucuronate isomerase [Streptococcus agalactiae 26 protmod 3 .FNTETFMLKNQAAIQLYEEVKRQPIFDYHCHLDPKDIFEDHIFDNIVDLWLGGDHYKWRLMRANGISEAEITGPASNLEKFKAFARTLERAYGNPVYHWSAMELKNVFGVNEILTESNAEEIYHRLNHFLKEISPRRLIADSKVMFIGTTDHPLDTLEWHKKLADESFKTVVAPTFRPDEAF-IEHRHFVDFITKLGDITQKEITDFSTFIAAMEERIAYFAQNGCRASDISFTEIVFEQTDELELNDLFNKVCEGYIPNQSEISKWQTAVFMELCRLYKKYGFVTQVHFGALRNNHSTIFEKLGADVGVDSLGDQVALTVNMNRLLDSLDSLPKMIWYNLNPAYNIAVANTLANFQALQFGAGWWFADTKLGMISQMNALAEQGMLANFIGMLTDSRSFLSY-QRHDYFRRILCTYLGEWIEEGEVPEDYLGSMAKDIAYQNAVNYF.. 464
19  0.000e+00 25  Xanthomonas campestris pv. campestris str. ATCC 33913 gi|21233539||ref|NP_639456.1| hexuronic acid isomerase [Xanthomonas campestris p protmod 5 LILHDDRLLTRAIARRLYAQTAALPIISPHGHTDPAWFATDAPFANATELLLVPDHYVFRMLYSQGIDLDQLGIPVDPREAWRVFASQFALLRGTPSALWLNHVFHQVFDLRIRLDAGSADHYYDHITAALPAFRPRALFERFNIEVIATTESPLDTLEHHATIRDSGWTGRVLTAYRPDAVVDPEHEQFASALQQFAALTGEDVMQWPGYLCAHRQRRAFFAAAGATSTDHGHPSAATADLSPAEAQRLFDTVVRGQ-ATPAQAELFRAQVLTEMAAMSVDDGLVMQLHPGCFRNHNRQLFERYGRDKGADIPMR-TDYVHALKPLLDRFDPRFRLIVFTLDETYSRELAPLAGHYPALLLGPAWWFHDAPEGMWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLDEDEAMEVAIDLAYRLPKQAY.. 469
20  0.000e+00 26  Xanthomonas oryzae pv. oryzae gi|32699763||sp|Q9AM27|UXAC_XANOR Uronate isomerase (Glucuronate isomerase) (Uro protmod 8 ..LHPDRLLTRAIAGRLYAQIATLPIISPHGHTDPAWFATNAPFADATELLLVPDHYVFRMLYSQGIDLDAIGIPRDPRAAWRVFAAHYTVLRGTPSALWLNHVFHDVFDLRLRLDAGTADHYYDHITAALPDFLPRALFERFNIEVIATTESPLDPLHHHAAIAASGWQGRVVTAYRPDPVVDPEHEQFAGALQQFGALTGEDVLTWNGYLRAHRQRRAFFAAHGATSTDHGHPSAATADLSPAQAQRLFDTVVRG-AATPEQAELFRAQVLTEMAAMSLDDGLVMQLHPGCFRNHNRPLFERYGRDKGADIPMR-TDYVHALKPLLDRYDRRLRLIVFTLDETYSRELAPLAGHYPSLLLGPAWWFHDAPEGMWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLEEDEATELAIDMAYRMPKRAY.. 470
21  0.000e+00 27  Brucella melitensis gi|32699753||sp|Q8YCQ2|UXAC_BRUME Uronate isomerase (Glucuronate isomerase) (Uro protmod 1 MALNPDRLFTREIARRLFASVEKLPIISPHGHTEPIWYARNEAFPDPASLFVKPDHYITRMLYSQGHSLESLGIASRDRKIWRLFATNWYLFRATPSRLWFEHAMETVFGITERLSQENADRIFDAIADQLPHMRPRALYDRFNIEAISTTDAATDPLIYHDEVIASGWHGRIIPAYRPDAAVDAGRPDFASEVEKLVGVAGTPL-TWQGYLDAHRNRREYFKRRGATSSDHGHPTAQTADLSAGDASRLFDRVIKGNAST-SDAEMFRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIP-RQTGFVDQLKPLLDAFDPRLTVILFTLDETASRELAPLAGHYPALKLGPAWWFFDSPEGILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLEEDEAYEVAHDLAYRLAKQTY.. 464
22  0.000e+00 26  Mesorhizobium loti MAFF303099 gi|13473453||ref|NP_105020.1| hexuronic acid isomerase HrmI [Mesorhizobium loti protmod 6 ...DPDLLFPRSLARDLYAGIKDLPIVSPHGHTDPRWYALNEPFPDPAQLLIVPDHYIFRMLFSQGVRLEDLGVETDGRTIWRRFAEHYYLFRGTPTRLWFDHVLAHLFGIEEPLDATTADRHYDTIATVLQNFRPRALFERFNIEVIATTEGALDDLEWHKMIRDSGWEGRVVTAYRPDAVVDPDFEGFSANLDRLGEITGCDTGSWAGYLDAHRQRRAFFKSFGATSSDHGHPTAETANLSDAAAQELFNRIRRGSQ-DERERKLFRAQMLTEMAKMSRDDGLVLQIHPGSWRNHSPSVFQRFGRDKGFDIPTR-TDYVTALKPLLDGLERDLTVILFTLDESYARELAPLAGVYPALKLGPAWWFHDSPEGMRRFREMTTETAGFYNTVGFNDDTRAFPSIPARHDVARRVDCAFLARLVAEHRLREDEAHELARELAHTLAKKAY.. 467
23  0.000e+00 25  Mesorhizobium loti MAFF303099 gi|58428644||gb|AAW77681.1| hexuronic acid isomerase [Xanthomonas oryzae pv. ory protmod 27 ..LHPDRLLTRAIAGRLYAQIATLPIISPHGHTDPAWFATNAPFADATELLLVPDHYVFRMLYSQGIDLDAIGIPRDPRAAWRVFAAHYTVLRGTPSALWLNHVFHDVFDLRLRLDAGTADHYYDHITAALPDFLPRALFERFNIEVIATTESPLDPLHHHAAIAASGWQGRVVTAYRPDPVVDPEHAQFAGALQQFGALTGEDVLTWNGYLRAHRQRRAFFAAHGATSTDHGHPSAATADLSPAQAQRLFDTVVRG-AATPEQAELFRAQVLTEMAAMSLDDGLVMQLHPGCFRNHNRPLFERYGRDKGADIPMR-TDYVHALKPLLDRYDPRLRLIVFTLDETYSRELAPLAGHYPSLLLGPAWWFHDAPEGMWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLEEDEATEVAIDLAYRMPKRAY.. 489
24  0.000e+00 26  Sinorhizobium meliloti 1021 gi|16264678||ref|NP_437470.1| putative glucuronate isomerase (uronic isomerase) protmod 10 LFPAEER--TRALARRLYAEVSGLPIVSPHGHTEPRWYALDEAFPDPAQLLIVPDHYVFRMLFSQGIRLEELGVPADGRAIWRRFCENYHLFRGTPTRLWFDYTLSELFGIDELPSAASSDPLYDHVAECLPDYRPRALYERFNIEVISTTDSALDDLGWHAKILESGWKGRVVPAYRPDAVVDPDFQGFPTNLDKLGDITGADTGTWSGYLDAHRTRRAYFKDFGATSTDHGHATADTANLPQAEAAALFDKVRLGK-ANADERRLFRAQMLTEMAKMSLDDGLVMQIHPGSFRNHSPAILAKFGRDKGFDIPTR-TDYVTALKPLLDALERDLTVILFTLDETYARELAPLAGVYPALKLGPAWWFHDSAEGMRRFREMTTETAGFYNTVGFNDDTRAFPSIPARHDIARRVDCAFLARLVAEHRLREDEAYELARDLAYGLAKEAY.. 467
25  0.000e+00 27  Brucella suis 1330 gi|23464177||gb|AAN33988.1| glucuronate isomerase, putative [Brucella suis 1330] protmod 1 MALNPDRLFTREIARRLFASVEKLPIISPHGHTEPIWYARNEAFPDPASLFVKPDHYITRMLYSQGHSLESLGIASRDRKIWRLFATNWYLFRATPSRLWFEHAMETVFGITERLSQENADRIFDAIADQLPHMRPRALYDRFNIEAISTTDAATDPLIYHDEVIASGWHGRIIPAYRPDAAVDAGRPDFASEVEKLVGVAGTPL-TWQGYLDAHRNRREYFKRRGATSSDHGHPTAQTADLSAGDASRLFDRVIKGNAST-SDAEMFRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIP-RQTGFVDQLKPLLDAFDPRLTVILFTLDETYSRELAPLAGHYPALKLGPAWWFFDSPEGILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLEEDEAYEVAHDLAYRLAKQTY.. 464
26  0.000e+00 27  Novosphingobium aromaticivorans DSM 12444 gi|48848139||ref|ZP_00302386.1| COG1904: Glucuronate isomerase [Novosphingobium protmod 7 ..LHPDRLLPRGLARELYASVRGLPVVSPHGHTDPRWFAGNGTFGNATELLLVPDHYVFRMLYSQGVALEDLGVQVDPRAAWRLFAERYWLFRGTPSRMWLDWVFAEAFGMGVQLCAGTADLYFDTITEMLAAFRPRALFERFNIEVLATTESPLDSLEHHAAIRASGWKGRVITAYRPDPVVDPDFEGFGANLDLLSHLTGEDCRTWTGYLAAHRQRRAFFASMGATSTDHGHPTAATANLPASEAEALFGKIVAG-AFTPAEAELFRAQMLTEMAAMSLDDGLVMQIHPGSFRNHNAQVFERFGRDKGADIPTR-TDFVHALKPLLDRFERDLSIILFTLDESYARELAPLAGHYPCLRLGPAWWFHDSPEGMRRFRRMTTETAGFYNTVGFNDDTRAFLSIPARHDVARRIDCGFLAELVAEHRIEDWEAAELARDLSYDLAKKAY.. 464
27  0.000e+00 25  Xanthomonas axonopodis pv. citri str. 306 gi|21110689||gb|AAM39086.1| hexuronic acid isomerase [Xanthomonas axonopodis pv. protmod 8 ..LHPDRLLTRAIARRLYAQVATLPIISPHGHTDPAWFATNAPFANATELLLVPDHYVFRMLYSQGIDLDALGIPRDPRAAWRVFAEHYTLLRGTPSALWLNHVFHDVFDLRIRLDAGTADHYYDHITAALPAFLPRALFERFNIEVIATTESPLDRLQHHAAIAASGWQGRVVTAYRPDPVVDPEHEQFAGALQQFGALTGEDVLTWDGYLRAHRQRRAFFAAHGATSTDHGHPSAATADLSPAEAQRLFDTVVRG-AATPEQAELFRAQVLTEMAAMSLDDGLVMQLHPGCFRNHNRQLFEQYGRDKGADIPMR-TDYVHALKPLLDRHDPRLRLIVFTLDETYSRELAPLAGHYPSLLLGPAWWFHDAPEGMWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLEEDEATEVAIDLAYRLPKQAY.. 470
28  0.000e+00 29  Rhodobacter sphaeroides 2.4.1 gi|22960035||ref|ZP_00007679.1| COG1904: Glucuronate isomerase [Rhodobacter spha protmod 4 ..LQEDRLFTRALARSLYATVKDLPIISPHGHTDPRWFAENEPFPDPAQLFVTPDHYVFRMLHSQGIPLEAMGVPTDGRKIWRLFASNFHLFRGTPSRLWLDHAFSEVFGVNERLSAETADAAYDQIADCLPEFRPRALFERFGIEAIATTESALDDLRWHRMIRESGWQGRVVTAYRPDAVVDPEFAGFAENVAQLGQLTGEDTATWEGYLAAHRKRRSYFKEFGATSSDHGHATARTEDLPQAEAAALFARALTG-ACTAEEADAFRGQMLTEMARMSLEDGLVLQIHPGSFRNHSRPVLDRFGRDKGFDIPTR-TDYVRALRPLLSAVDPRLTVIVFTLDETYARELAPLAGVYPALKLGPAWWFHDSPEGMRRFREMTTETAGFYNTVGFNDDTRAFCSIPARHDVARRVDCAFLATLVATGRLDAEEAPEVAHDLAYRLAKEAY.. 466
29  0.000e+00 35  Lactococcus lactis subsp. lactis Il1403 gi|15673610||ref|NP_267784.1| glucuronate isomerase [Lactococcus lactis subsp. l protmod 3 .FLSEDFLLTNESAKMLFHHAEKMPIIDYHCHLEPAEIYENKKYENLTQIWLGGDHYKWRLLRANGIPEKLITGDGEDYEKFLAFAKTLEKSFGNPIYEWTHLELKRFFHIDKLISSETAKEIWDEANQMLADFRPRALIKNSQVKVVCTTDDPVSTLSYHKLLAKEEKDFKVLPALRPDHLISITDGHFADYLTELSAVSGIEIKGFKTMIKALEQRFEFFTSLGGRLSDHSLSTYTFAETKNVDLDSILQKAKENQTLTDLEYNQYITALILEIMKLNKKFEWTMQLHVNVNRSINGPALSKIGENTGFDSMGTQANISEELTKLFSELETIPKTILYSLNQNDWLELVTMIGCFQQLQLGAGWWFNDTKKGMENQLEIFASQSLLSNFVGMLTDSRSFLSYP-RHEYFRRVLCNFVGQLIENGRIPDNEAGKMIEDISYNNVHDYF.. 462
30  0.000e+00 27  Microbulbifer degradans 2-40 gi|48861251||ref|ZP_00315154.1| COG1904: Glucuronate isomerase [Microbulbifer de protmod 7 ..LHPDRLFPRDIARRLYNDIKNLPIVSPHGHTDPQWFAANQNFSNPAELLIKPDHYVFRMLYSQGIRLESIGSETDARKIWQIFADHYYLFRGTPSQMWMDYVLHEVFGVTHQLCNQTANTIYDSINEQLAAFKPRALFERFNIELLATTESPLDNLAHHQTILDSGWTGRVITAFRPDPVVDPEFEGFSQNIDKLAELTGEDVSTFNGYLKALANRREYFKRYGATSTDHGHPSALTADLSQSEKENLYLLARSGE-ISAQEAELFRGQMLTEMAAMSLDDGLVIQIHPGCYRNHNQQIFAQFGRDKGADLPLA-TEYVHNLKPLLDKFNPDLTIILFTLDETYSRELAPLAGHYPALKLGPAWWFHDSPEGMRRYRQQITETAGFYNTVGFNDDTRAFLSIPARHDVARRMDCGFLAELVADHRLSENDAHELAVDLTYNLVKKAY.. 469
31  0.000e+00 34  Geobacillus stearothermophilus gi|4056665||gb|AAC98133.1| uronate isomerase [Geobacillus stearothermophilus] gi protmod 4 .FIHENFLLQNKHAEVLYHYAKSLPIIDYHCHLSAKEIAEDRRFHDMTELWLEGDHYKWRAMRALGVEEKYITGNASPEEKFQAWAKTVPYCIGNPLYHWTHLELKRYFQVDALLNERTWREIWNHCNDLLRQFSARSFMVKSNVEWIGTTDDPLDDLADHQAIADPSFLVKIVPSFRPDAVIEINRPSFLDYVGKLGEALACRFMITISCCKPLENRVRYFHEKGCRMADHGLESMPYSECGWKEANDIFQKRKNGFVLSREEEEKYKTSTLCFLARLYHSLGWVMQLHIGSIRNTNEKMFRRLGPNTGYD-SIHDFFLAQPLNAFLNELDQLPKTIVYTLNPAYNYVVASTVGNFQSVKGKVPIWFNDSKMAFIRHLTDLANVGVFSTFVGMLTDSRSFVSY-VRHEYFRRIVCNLIGSWIEKGEVPQDYLGKIVQDVCYFNAKQYF.. 466
32  0.000e+00 36  Bacteroides fragilis YCH46 gi|53713582||ref|YP_099574.1| uronate isomerase [Bacteroides fragilis YCH46] gi| protmod 4 .FMDKNFLLQTETAQELYHHAAKMPIIDYHCHLNPQMVADDYRFKSLTEIWLGGDHYKWRAMRSNGVDECFCTGKTSDWEKFEKWAETVPYTFRNPLYHWTHLELKTAFGIDKVLNPKTAREIYDECNEKLQEYSARGMMRRYHVETVCTTDDPIDSLEYHIRTRESGFEIKMLPTWRPDKVMAVEVPDFRTYIEKLSEISEITISDYNDMILALRKRHDYFAEQGCKLSDHGIEEFYAEDYTEGEIKTIFNKIYGGSELTKEEVLKFKSAMLIVLGEMDWEKGWTQQFHYGAIRNNNSRMFKQLGPDTGFD-SIGEFATAKAMSKFLDRLNKLTKTILYNLNPCANEVIATMIGNFQKIQFGSGWWFLDQKDGMERQLNALSLLGLLSRFVGMLTDSRSFLSYP-RHEYFRRTLCNLLGCDVENGEIPLSEMEQMVEDISYFNAKNFF.. 466
33  0.000e+00 38  Enterococcus faecium gi|48826479||ref|ZP_00287683.1| COG1904: Glucuronate isomerase [Enterococcus fae protmod 1 MFLSDDFLLKDDWAKKLYHYAKNMPIIDYHCHLDPKEIYENNNFSNLTEAWLGGDHYKWRLMRACGVPEEKITGNASDFEKFLAWCQTVPKIIGNPLYSWSHLELKRFFGIDLLINEENAEKIWTQANEILPDFRRREIAKKSNVEVICTTDDPADDLHYHQLLAHEEPDLKVLPSFRPDKALNIEKEGFNAWVTLLEEAADQTITTYQELIEVLGQRIEYFHQHGCRVSDHALDILRYKEADETVLEEIFQKARANKLLSSDEIDAYRTETLIHLTHFYHSHNWTMQLHIHAYRNCNTQMLEKLGPDTGYD-GMNDLSLTIPLQKLLNETDQLPKTILYSLNPNDYPAILALMGCFQKLQLGSGWWYNDTRAGMRDQLTQFADGSALGNFVGMLTDSRSFLSY-TRHEYFRRVLCEFLGEMVMRGEAPEDELGSLVQAISYTNAKNYF.. 460
34  0.000e+00 29  Microbulbifer degradans 2-40 gi|48860629||ref|ZP_00314541.1| COG1904: Glucuronate isomerase [Microbulbifer de protmod 4 LILHPDRLFPRGIARRLYAEVKDLPIVSPHGHTDPSWFADNQPFDSAADLLIKPDHYVFRMLYSLGVPLESLGVPTDGRKIWQTFAKHYTAFRGTPSRMWLDHVFKDVFGFEKALSAATADDYYDGINAALPEFLPRALFDRFKIEWLATTESPLNDLRHHQKIRESGWKGNVITAYRPDPVVDPDFEGFASNVAYLGKITGEDTSNWEGYLAALRNRREYFKAHGATSTDHGHPTAVTADLSRPEIETLFAKALAGK-CSAAEAELFRGQILTEMAGMSLEDGLVMQIHPGSFRNHNPKLFARYGRDKGADIP-SQTEYVNALKPLLDKYEPNLTIILFTLDETYSRELAPLAGHYPALKLGPSWWFHDSPEGMRRFREQVTETAGFYNTVGFNDDTRAFLSIPARHDVARRMDCGFLAKLVSEHRLQEDEAREVAIDLTYNLVKQAY.. 468
35  0.000e+00 36  Clostridium acetobutylicum ATCC 824 gi|15893980||ref|NP_347329.1| Glucuronate isomerase [Clostridium acetobutylicum protmod 4 .FMDEKFMLSTKVAEDLYNDAKDMPIIDYHCHISPQEICENKSFKNITEVWLYGDHYKWRLMRSSGVDEKYITGDSSDYEKFLAYVKAIETAIGNPLYHWSHLELQRYFGVYEVISEKNAPVIWEKANKVLNDLTVREIIKKSNVKAICTTDDPIDSLEYHLKLKEDTFNVKVLPAFRPDKALGINKDGYTDWVSKLAKVSKKNINSYDMFLEALNDRIEFFHSVGGRVSDHALDYVPYLEASKEEVNTIFAKALKGEKVSFEEETKFRTFTMKFLGKKYASLGWAMELHMNAKRDNNTRMYNKLGPDTGFD-SVNDNGVAGPLSRFLDSLEKLPKTIIYSLNPNDNFVIGTLLGCFQKIQFGAAWWFNDHRDGMVEQMETLANLGAFSTFIGMLTDSRSFLSY-TRHEYFRRILCDLIGKWVENGEVPNDLLGRITKNICFNNANNYF.. 463
36  0.000e+00 37  Bacillus halodurans C-125 gi|10173319||dbj|BAB04424.1| uronate isomerase [Bacillus halodurans C-125] gi|32 protmod 4 .FLSEDFLLMNEYDRELYYTAKNMPICDYHCHLSPQEIWENKPFENMTKAWLGGDHYKWRAMRLNGVREEFITGGAPDKEKFLAWAKTVPKTIGNPLYHWTHMELKTYFHFHQPLDETNGENVWDACNRLLQQFTPRALIERSNVRAIGTTDDPTDSLLYHQKLADDTFHVKVIPTFRPDGALKIEQDSFADWVAKLSDVTGESLDTLDAFLHALKERLTFFDEHGCRSSDHDMTEVPFVEVNEQEAQHIFRKRLANEGLTKVENEKYKTFLMTWLGKEYAARGWVMQWHIGVMRNNNSRMLHKLGPDTGFD-SIGDGQIAHATAKLLDLLDKLPKTILYCVNPNANYILASMIGNFTKVQFGSAWWFNDHIDGMRRQLTDLASVGLLSNFIGMLTDSRSFLSYP-RHDYFRRILCQLIGSWIKEGQLPPDRWGQIVQDICYNNVVDYF.. 464
37  0.000e+00 39  Bacillus clausii KSM-K16 gi|56962769||ref|YP_174495.1| uronate isomerase [Bacillus clausii KSM-K16] gi|56 protmod 8 .FIHENFMLQNKTAETLYHYAKTLPIIDYHCHVPPQEIAENRQFNNISEIWLHGDHYKWRAMRAVGVEETFITGDGDDKEKFLKWAETVPYTMGNPLYHWTHLELKRYFGIDELLSSETAEAIWSATKEQLPERSVQGIIKESNVKVICTTDDPSDHLEAHQQIRKEGCQAAVYPAFRPDKALVASAPSFVPYLETLGAAAEVDISSLRSLLEALEKRATFFAEEGCVLSDHGLRTLPFVDTTEKEAEAAFQKALNQETLTPQEEEKYQTYVLLFLARLYNKLGWTMQFHLGALRNNNSRMVEQVGPDSGFD-SMADDRFAESLNRFLNELNELPKTILYTLNPIFNEVIATTIGNFQKIQFGSGWWFNDTKDGMEKQMTDLANNGLLSLFVGMLTDSRSFLSY-TRHEYFRRILCNRIGEWVERGEWPADELGKVVEDISYYNAKRYF.. 468
38  0.000e+00 36  Clostridium perfringens gi|32699752||sp|Q8XP14|UXAC_CLOPE Uronate isomerase (Glucuronate isomerase) (Uro protmod 4 .FMDKDFLLENEVAKVLYHYASKVPVFDYHCHLVPMEIATDHKFKNLTEMWLYHDHYKWRAMRSFGIDEEYITGNASDYDKFYQFAKMMPYLIGNPIYHWSHLELKRFFGVEETLSEKTASTIWEKCNKVIENLTAKKLIEMANVVYIGTTDDPIDDLRYHKQLKEDNFKCSVNPSFRPEKAMKIQNEGFKEYIGKLAEVSNVEIKSFDDLKKALEIRLDYFYENGCMITDHSLERVVFYKFSCEEINEIFIKALNGENINNEEASKYSVALLISLGKMYAERNMVMQLHIGALRNNNTRMFNRIGADAGFD-SIDDGEIAYSLSRILDELDKLPKTILYCLNPKDNEVLGTMIGNFQKIQFGSGWWFNDQKDGMERQMMALSQLGLISQFVGMVTDSRSFLSY-TRHEYFRRILCNYLGNLVESGQYPYEELGEIVQNICYKNSAKYF.. 464
39  0.000e+00 37  Bacteroides thetaiotaomicron gi|32699740||sp|Q8A9J2|UXAC_BACTN Uronate isomerase (Glucuronate isomerase) (Uro protmod 4 .FMDENFLLQTETAQKLYHHAAKMPIIDYHCHLIPQMVADDYKFKSLTEIWLGGDHYKWRAMRTNGVDERYCTGDTTDWEKFEKWAETVPYTFRNPLYHWTHLELKTAFGIDKILSPKTAREIYDECNEKLPEYSARGMMRRYHVEVVCTTDDPIDSLEYHIQTRESGFEIKMLPTWRPDKAMAVEVPDFRAYVEKLSAVSGVTISNFDDMIAALRKRHDFFAEQGCRLSDHGIEEFYAEDYTDAEIKAIFNKVYGGAELTKEEILKFKSAMLVIFGEMDWEKGWTQQFHYGAIRNNNTKMFKLLGPDTGFD-SIGEFTTAKAMSKFLDRLNKLTKTILYNLNPCANEVIATMLGNFQKIQFGSGWWFLDQKDGMEKQMNALSVLGLLSRFVGMLTDSRSFLSYP-RHEYFRRTLCNLVGRDVENGEIPVDRVNQMIEDISYNNAKNFF.. 466
40  0.000e+00 37  Oceanobacillus iheyensis HTE831 gi|23097822||ref|NP_691288.1| glucuronate isomerase; uronate isomerase [Oceanoba protmod 4 .FMDDNFLLSNDTAEELFHYAKDMPIIDYHCHLSPKEIYMNKRYSNITEVWLYGDHYKWRAMRAAGVEESLITGDANDYDKFMAWAETVPKLIGNPLYNWTHLELQRYFGVDEILNKESGPSIWEKVNKCLADFGVRELINQSNVQVVCTTDDPIDDLSFHQMLEDDDFSVKVLPGFRPDKAIEINQEGFIDYVDSLEKVTSHSTKTYDGFLRALKSRVDYFHQNGCSVADHALNTMMFTETTKEKARNYYEKAMNGQKLSPKEESDFKSFTLVFLGEQYADKGWVMQYHINALRNNNSRMYNNLGPDTGYD-AMNDEVISKPLVNLLNELDRLPKTILYSLNPNDNPVIASIIGSFQKLQFGTAWWFNDTKSGMIKQMQTLADIGVFSQFIGMLTDSRSFLSYP-RHEYFRRLVCSLIGEWVHNGEVPYDLLGEIVQDISYYNAARYF.. 464
41  0.000e+00 36  Bacillus subtilis subsp. subtilis str. 168 gi|16078295||ref|NP_389112.1| glucuronate isomerase [Bacillus subtilis subsp. su protmod 4 .FMGKNFLLKNETAVSLYHYAKDMPIIDYHCHLSPKEIYENKTFQNITEAWLYGDHYKWRIMRANGIEETYITGDAPDEEKFMAWAKTVPMAIGNPLYNWTHLELQRFFGIYEILNEKSGSAIWKQTNKLLEGFGARDLIVKSNVKVVCTTDDPVDSLEYHLLLKEDDFPVSVLPGFRPDKGLEINREGFPEWVQALEDAAAISITTYDEFLKALEKRVRFFHSAGGRVSDHAIDTMVFAETTKEEAGRIFSDRLQGTEVSCEDEKKFKTYTLQFLCGLYAELDWAMQFHINALRNTNTKMMKRLGPDTGYD-SMNDEEIAKPLYKLLNSVNQLPKTILYSLNPNDNYVIASMINSFQKIQFGTAWWFNDTKDGMLDQMKALSNVGLFSRFIGMLTDSRSFLSY-TRHEYFRRIVCNLIGEWVENGEVPRDLLGSIVQGICYDNAKHYF.. 464
42  0.000e+00 37  Bacteroides thetaiotaomicron VPI-5482 gi|29346233||ref|NP_809736.1| uronate isomerase [Bacteroides thetaiotaomicron VP protmod 18 .FMDENFLLQTETAQKLYHHAAKMPIIDYHCHLIPQMVADDYKFKSLTEIWLGGDHYKWRAMRTNGVDERYCTGDTTDWEKFEKWAETVPYTFRNPLYHWTHLELKTAFGIDKILSPKTAREIYDECNEKLPEYSARGMMRRYHVEVVCTTDDPIDSLEYHIQTRESGFEIKMLPTWRPDKAMAVEVPDFRAYVEKLSAVSGVTISNFDDMIAALRKRHDFFAEQGCRLSDHGIEEFYAEDYTDAEIKAIFNKVYGGAELTKEEILKFKSAMLVIFGEMDWEKGWTQQFHYGAIRNNNTKMFKLLGPDTGFD-SIGEFTTAKAMSKFLDRLNKLTKTILYNLNPCANEVIATMLGNFQKIQFGSGWWFLDQKDGMEKQMNALSVLGLLSRFVGMLTDSRSFLSYP-RHEYFRRTLCNLVGRDVENGEIPVDRVNQMIEDISYNNAKNFF.. 480
43  0.000e+00 37  Haemophilus somnus 129PT gi|23467618||ref|ZP_00123198.1| COG1904: Glucuronate isomerase [Haemophilus somn protmod 4 .FMTEDFLLSTSTAQKLYHYAEEQPIFDYHCHLNPKEIAENRQFNDLAEIWLEGDHYKWRAMRSAGVEEHLITGSADKYSKYLAFANTVPKCIGNPIYHWTHLELRRPFGITDTISPETAEKIWHKGKELLPEFSARGIMKKMNVNLVGTTDDPIDSLEYHKAIADDTFDVEVVPSFRPDRAFKIELPLFNDYIEQLGKVADIEINTFDKLKQALSKRIEHFDKYGCKSADHGMEIVRFSPIDEKTLDQILQKRLNNQPIEEEEIAQFSTALLVWLGTEYHKHHWVMQLHIGAIRNNNTRMFKLLGADAGFD-SIGDRAFAESLSRLLDSMDQLPKTILYCLNPRDNEMLGTMIGNFQKIQFGSGWWFNDQKDGMERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVERGEAPNDLLGKMVKDICYDNAKRYF.. 466
44  0.000e+00 37  Haemophilus somnus 2336 gi|53728726||ref|ZP_00131831.2| COG1904: Glucuronate isomerase [Haemophilus somn protmod 4 .FMTEDFLLSTSTAQKLYHYAEEQPIFDYHCHLNPKEIAENRQFNDLAEIWLEGDHYKWRAMRSAGVEEHLITGSADKYSKYLAFANTVPKCIGNPIYHWTHLELRRPFGITDTISPETAEKIWHKGKELLPEFSARGIMKKMNVNLVGTTDDPIDSLEYHKAIAEDTFDVEVVPSFRPDRAFKIELPLFNDYIEQLGKVADIEINTFDKLKQALSKRIEHFDKYGCKSADHGMEIVRFSPIDEKTLDQILQKRLNNQPIEEEEIAQFSTALLVWLGTEYHKHHWVMQLHIGAIRNNNTRMFKLLGADAGFD-SIGDRAFAESLSRLLDSMDQLPKTILYCLNPRDNEMLGTMIGNFQKIQFGSGWWFNDQKDGMERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVERGEAPNDLLGKMVKDICYDNAKRYF.. 466
45  0.000e+00 38  Bacillus licheniformis ATCC 14580 gi|52081820||ref|YP_080611.1| glucuronate isomerase [Bacillus licheniformis ATCC protmod 4 .FLNDDFLLTNETSKVLYHYAKGMPIIDYHCHLSPKEIYENKTFKNLTEVWLYGDHYKWRAMRANGISEEFITGDASDEEKFSAWARTVPMTIGNPLYHWTHLELRRFFGIDDRLDEKSAPHIWERVNEQLAGFGARDLIEKSNVETVVTTDDPTDSLEYHVKLKDEDFNVSVLPGFRPDKAMEINQEGFAAWVRKLETASGMKIANYDDFLKALKNRIDFFHEAGGRISDHAINQMMYTETDESEVRPIFAKVMNGESASPEEECKFKSLTLHFLGTCYAEKGWAMQLHINALRNNSSKMYRKLGPDTGYD-AINDQDIAKPLCSFLDSLDRLPKTILYSLNPRDNVVISSLCGSFQKIQHGTAWWFNDTKDGMLEQMKSLANIGLLSRFIGMLTDSRSFLSY-TRHEYFRRLLCDVIGTWVENGEAPDDLLGRIVKGICYENAKHYF.. 463
46  0.000e+00 39  Thermoanaerobacter tengcongensis MB4 gi|20808343||ref|NP_623514.1| Glucuronate isomerase [Thermoanaerobacter tengcong protmod 4 .FMDEDFLLTNETAVKLYHYAKDMSIYDFHCHLSPKEIYEDRRFKNITEVWLYGDHYKWRLMRANGIDEKYITGDADDYEKFVAYAKTIPMAIGNPVYHWTHLELQRYFGIYDLLNEKTAKSIWERANEVIEDFSARNILKKSNVKVVITTDDPVDSLEYHIKLKEEDFDIKVLPAFRPDKGLNIEKDDFLSWIKKLESASGIKITTYDDFLQALEKRIEFFHSVGCRISDHALDYVFYQKTSKQEAEKVFKKVLTEQHLTKEEIDSFKTYTMIFLGKKYAELNWVMQLHIGAMRNNNTKMYRILGPDTGYD-SIGDFPIAYSLSRLLDSLEALPKTILYTLNPAANYVIATMIGNFQKMQFGAAWWFNDNKDGIKEQLKTLANVGLLGRFVGMVTDSRSFLSY-ARHEYFRRILCDLIGEWVENGEVPNDLLGKIVQDISFNNAKEY... 463
47  0.000e+00 35  Vibrio vulnificus CMCP6 gi|27367460||ref|NP_762987.1| Glucuronate isomerase [Vibrio vulnificus CMCP6] gi protmod 4 .FLCEDFLLSNETARRLYHHACHQPIYDYHCHLNPAEVAQNRQFDNLGQIWLEGDHYKWRGMRSAGIEERLITGDASDYDKYMAWAKTVPQTLGNPLYHWTHLELRRPFGITNTLSPDTADQIWHQCNELLPEFTARGIMQQMNVVMAGTTDDPIDSLKHHKTIADDTFNVKVLPSWRPDKAFKIELDLFADYMHKLGEVADIEIRRFDDLLSALDKRLAHFDAHGCRAADHGIEIVRYAPISEADLDVLLARRLNGEVLSELECAQFSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLLGADAGFD-SIGDRPFAFELAHLLDEMDQLPRTILYCLNPRDNEMMATMIGNFQKVQFGSGWWFNDQKDGMQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVPNDLLGPMVEDICFGNAKRYF.. 466
48  0.000e+00 36  Vibrio parahaemolyticus RIMD 2210633 gi|28901561||ref|NP_801216.1| putative uronate isomerase [Vibrio parahaemolyticu protmod 4 .FLCEDFLLSNETARRLYHHAFHQPIYDYHCHLNPAEVTQNRQFDNLGQIWLEGDHYKWRGMRSAGIEERLITGDASDYDKYMAWAKTVPQTLGNPLYHWTHLELRRPFGITNTLSPDTADQIWHQCNELLPEFTARGIMQQMNVVMAGTTDDPIDSLEHHKAIADDTFNVKVLPSWRPDKAFKIELDLFADYMHKLGEVADIDIRRFDDLLSALDKRLAHFDSHGCRAADHGIEIVRYAPISEADLDALLARRLSGEVLSELECAQFSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLLGADAGFD-SIGDRPFAFELAHLLDEMDQLPRTILYCLNPRDNEMMATMIGNFQKVQFGSGWWFNDQKDGMQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVPNDLLGPMVEDICFGNAKRYF.. 466
49  0.000e+00 35  Vibrio vulnificus YJ016 gi|37677254||ref|NP_937650.1| glucuronate isomerase [Vibrio vulnificus YJ016] gi protmod 4 .FLCEDFLLSNETARRLYHHAFHQPIYDYHCHLNPAEVAQNRQFDNLGQIWLEGDHYKWRGMRSAGIEERLITGDASDYDKYMAWAKTVPQTLGNPLYHWTHLELRRPFGITNALSPDTADQIWHQCNELLPEFTARGIMQQMNVVMAGTTDDPIDSLEHHKAIADDTFNVKVLPSWRPDKAFKIELDVFADYMHKLGEVADIEIRRFDDLLSALDKRLAHFDAHGCRAADHGIEIVRYAPISEADLDALLARRLSGEVLSELECAQFSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLLGADAGFD-SIGDRPFAFELAHLLDEMDQLPRTILYCLNPRDNEMMATMIGNFQKVQFGSGWWFNDQKDGMQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVPNDLLGPMVEDICFGNAKRYF.. 466
50  0.000e+00 33  Haemophilus influenzae gi|48243747||gb|AAT40849.1| putative glucuronate isomerase [Haemophilus influenz protmod 4 .FMDENFLLSTDTAKILYHYAKNKPIFDYHCHLNPREVAENRQFNDLAEIWLEGDHYKWRALRTAGVPEELITGKATNYQKYLAWAKTVPLCIGNPIYHWTHLELRRPFGITNMLNPQNAEKIWHQCNEMLPEFSARGIMQKMNVKLVGTTDDPIDSLQYHQAIKDESFDIDVVPSWRPDKVFKIELPQFNDYLVQLSEIADVDIYTFADLKKALLKRLEYFDAQGCKSADHGMEIVRFSAIDESVLNSILQKRLQNQPLLEEEVAQFSTAILVWLASEYCKRHWVMQMHIGAIRNNNSRMFALLGADSGFD-SIGDRTYAYPLSRLLDAMDQLPKTILYCLNPRDNEMIASMIGNFQKIQFGSGWWFNDQKDGMERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVEKGEAPNDLLGKMIEDICFNNAKNYF.. 466
51  0.000e+00 37  Mannheimia succiniciproducens MBEL55E gi|52424599||ref|YP_087736.1| UxaC protein [Mannheimia succiniciproducens MBEL55 protmod 34 .FMDEDFLLSNDVARTLYYYAKDQPIFDYHCHLPPKEIAENRQFKDLTEIWLAGDHYKWRAMRSAGVDENLITGNASNYEKYQAWAKTVPLCIGNPIYHWTHLELRRPFGITNTLNPQSADKIWQECNELLPEFSARGIMRQMNVKFSGTTDDPIDSLEYHKAIAEDDFDIEVAPSWRPDKAVKIELPQFNDYIKQLEQVSDTEINGFDSLKKALSKRLDHFDKRGCKSADQGMEIVRFAPVDEKELDRILQLRRNEQPLTELQISQFSTALLVWLGAEYCKRNWVMQMHIGALRNNNTRMFKLLGADSGFD-SIADRTFAEQLSRLLDAMDQNPKTILYCLNPRDNEMIATMIGNFQKIQFGSGWWFNDQKDGMERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGRWVVNGEAPNDLLGNMVKNICFDNAKAYF.. 496
52  0.000e+00 35  Yersinia pseudotuberculosis IP 32953 gi|51597770||ref|YP_071961.1| uronate isomerase [Yersinia pseudotuberculosis IP protmod 4 .FLTEDFLLDTEFARRLYHYAKDQPIFDYHCHLPPEQIAENYRFKNMYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPATSEEIWQRGNELLAQFSARGIMQQMNVKMVGTTDDPIDDLRHHKAIAADGFNIKVLPSWRPDKAFNIEAAGFNDYMQRLEAAADTSISRFADLCVALNKRMDHFAAHGCKVSDHALDVVVYGEADETTLDAILARRLAGNQPSTEEIAQFKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFD-SINDQPLAQPLSRLLDARNALPKTILYCLNPRDNEVIGTMVGNFQKMQFGSGWWFNDQKDGMQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAPADLLGAMVKNICFDNAQQYF.. 465
53  0.000e+00 35  Yersinia pestis biovar Medievalis str. 91001 gi|45442665||ref|NP_994204.1| uronate isomerase [Yersinia pestis biovar Medieval protmod 12 .FLTEDFLLDTEFARRLYHYAKDQPIFDYHCHLPPEQIAENYRFKNMYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPATSEEIWQRGNELLAQFSARGIMQQMNVKMVGTTDDPIDDLRHHKAIAADGFNIKVLPSWRPDKAFNIEAAGFNDYMQRLEAAADTSISRFADLCVALNKRMDHFAAHGCKVSDHALDVVVYGEADETTLDAILARRLAGNQPSTEEIAQFKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFD-SINDQPLAQPLSRLLDARNALPKTILYCLNPRDNEVIGTMVGNFQKMQFGSGWWFNDQKDGMQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAPADLLGAMVKNICFDNAQQYF.. 473
54  0.000e+00 34  Salmonella enterica subsp. enterica serovar Typhi Ty2 gi|29143402||ref|NP_806744.1| uronate/glucuronate isomerase [Salmonella enterica protmod 4 .FMTEDFLLKNDIARTLYHYAAPMPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYKWRALRSAGVDESLITGKTSDYEKYMAWANTVPKTLGNPLYHWTHLELRRPFGITGTLGPDTAESIWTQCNEKLPAFSARGIMQQMNVRMVGTTDDPIDSLEYHHQIADDSIDIEVAPSWRPDKVFKIELDGFVDYLGKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHGIETLRFAPVDDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFD-SIGDNNISWALSRLLDSMDELPKTILYCLNPRDNEVLATMIGNFQKVQFGSGWWFNDQKDGMLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIPDDEAMRMVQDICFNNAQRYF.. 467
55  0.000e+00 34  Salmonella typhimurium LT2 gi|16421691||gb|AAL22011.1| putative uronate isomerase [Salmonella typhimurium L protmod 4 .FMTEDFLLKNDIARTLYHYAAPMPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYKWRALRSAGVDESLITGKTSDYEKYMAWANTVPKTLGNPLYHWTHLELRRPFGITGTLGPDTAESIWTQCNEKLPAFSARGIMQQMNVRMVGTTDDPIDSLEYHRQIADDSIDIEVAPSWRPDKVFKIELDGFVDYLRKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHGIETLRFAPVDDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFD-SIGDNNISWALSRLLDSMDELPKTILYCLNPRDNEVLATMIGNFQKVQFGSGWWFNDQKDGMLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIPDDEAMRMVQDICFNNAQRYF.. 467
56  0.000e+00 36  Photorhabdus luminescens subsp. laumondii TTO1 gi|37524198||ref|NP_927542.1| uronate isomerase (glucuronate isomerase) (uronic protmod 4 .FMCDDFLLNNETARQLYHHAADMPIYDYHCHLNPREIAENRRFDNLGQIWLEGDHYKWRAMRCAGIDESLITGKTRDYEKYQAWAETVPLTLGNPLYHWTHLELRRPFGISGILGPQTADEIWHQCNEKLPAFSARGIMQQMNVRMVGTTDDPVDSLQYHRQIADESFDIEVLPSWRPDRVFKIELAGFIDYIKQLEAVADVSIVAFADVLNALERRLEHFAAHGCRAADHGIENLRYAPIDETVLNGILQKRLAGGILSELEIAQYTTAILVWLGRQYAARGWVMQMHIGAIRNNNSRMFRLLGADSGFD-SIGDNNIAWPLSRLLDSMDELPKTILYCLNPRDNEVIATMASNFQKVQFGSGWWFNDQKDGMLRQLEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNVLGQWAEKGEIPNHKAGQIVEDICFNNARRYF.. 467
57  0.000e+00 34  Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150 gi|56415079||ref|YP_152154.1| uronate isomerase (glucuronate isomerase) [Salmone protmod 4 .FMTEDFLLKNDIARTLYHYAAPMPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYKWRALRSAGVDESLITGKTSDYEKYMAWANTVPKTLGNPLYHWTHLELRRPFGITSTLGPDTAESIWTQCNEKLPAFSARGIMQQMNVRMVGTTDDPIDSLEYHRQIADDSINIEVAPSWRPDKVFKIELDGFVDYLGKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHGIETLRFAPVDDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFD-SIGDNNISWALSRLLDSMDELPKTILYCLNPRDNEVLATMIGNFQKVQFGSGWWFNDQKDGMLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIPDDEAMRMVQDICFNNAQRYF.. 467
58  0.000e+00 37  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50119594||ref|YP_048761.1| uronate isomerase [Erwinia carotovora subsp. atros protmod 4 .FLSEDFLLDTEFARRLYHYAVDQPIFDYHCHLPPEQIAENYRFKNLYDIWLKGDHYKWRAMRTNGVPERLCTGDASDWEKFEAWAATVPHTIGNPLYHWTHLELRRPFGVTTLLSPSTAKGIWDRCNAMLEDFTARGIMQQMNVKMVGTTDDPIDDLRHHKAVADSSFSIKVLPSWRPDKAFNIELATFNDYMAKLGEVSDTDIRRFSDLQTALTKRLDHFAAHGCKVSDHALDVVMFAEADDATLDKILARRLAGETLSEHEVAQFKTGVLVWLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFD-SINDRPLAQELSRLLNEENLLPKTILYCLNPRDNEVLGTMIGNFQKMQFGSGWWFNDQKDGMQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEDGEAPADLLGEMVKNISFDNAKNYF.. 465
59  0.000e+00 37  Escherichia coli O157:H7 gi|12517682||gb|AAG58225.1| uronate isomerase [Escherichia coli O157:H7 EDL933] protmod 4 .FMTEDFLLDTEFARXXYHYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPSTADEIWNECNELLAQFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFD-SINDRPMAEELSKLLNEENLLPKTILYCLNPRDNEVLGTMSGNFQKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAPADLLGEMVKNICFNNARDYF.. 465
60  0.000e+00 37  Escherichia coli O157:H7 gi|32699751||sp|Q8XAI7|UXAC_ECO57 Uronate isomerase (Glucuronate isomerase) (Uro protmod 4 .FMTEDFLLDTEFARRLYHYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPSTADEIWNECNELLAQFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFD-SINDRPMAEELSKLLNEENLLPKTILYCLNPRDNEVLGTMSGNFQKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAPADLLGEMVKNICFNNARDYF.. 465
61  0.000e+00 37  Shigella flexneri 2a str. 301 gi|56480255||ref|NP_708897.2| uronate isomerase [Shigella flexneri 2a str. 301] protmod 4 .FMTEDFLLDTEFARRLYHYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPSTADEIWNECNELLAQFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFD-SINDRPMAEELSKLLNEENLLPKTILYCLNPRDNEVLGTMIGNFQKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAPADLLGEMVKNICFNNARDYF.. 465
62  0.000e+00 37  Escherichia coli CFT073 gi|26249681||ref|NP_755721.1| Uronate isomerase [Escherichia coli CFT073] gi|261 protmod 25 .FMTEDFLLDTEFARRLYHYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITKLLSPSTADEIWNECNELLAQFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFD-SINDRPMAEELSKLLNEENLLPKTILYCLNPRDNEVLGTMIGNFQKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAPADLLGEMVKNICFNNARDYF.. 486
63  1.000e-95 34  Haemophilus influenzae 86-028NP gi|48867207||ref|ZP_00320789.1| COG1904: Glucuronate isomerase [Haemophilus infl protmod 1 ..MDENFLLSTDTAKILYHYAKNKPIFDYHCHLNPREVAENRQFNDLAEIWLEGDHYKWRALRTAGVPEELITGKATNYQKYLAWAKTVPLCIGNPIYHWTHLELRRPFGITNMLNPQNAEKIWHQCNEMLPEFSARGIMQKMNVKLVGTTDDPIDSLQYHQAIKDESFDIDVVPSWRPDKVFKIELPQFNDYLVQLSEIADVDIYTFADLKKA............................................................................................................................................................................................................................................. 217
64  5.000e-82 31  Haemophilus influenzae 86-028NP gi|48866870||ref|ZP_00320562.1| COG1904: Glucuronate isomerase [Haemophilus infl protmod 1 .........................................................................................................................................................................................................................................MEIVRFSAIDESVLNSILQKRLQNQPLLEEEVAQFSTAILVWLASEYCKRHWVMQMHIGAIRNNNSRMFALLGADSGFD-SIGDRTYAYPLSRLLDAMDQLPKTILYCLNPRDNEMIASMIGNFQKIQFGSGWWFNDQKDGMERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVEKGEAPNDLLGKMIEDICFNNAKNYF.. 226
65  1.000e-70 37  Actinobacillus pleuropneumoniae serovar 1 str. 4074 gi|32033964||ref|ZP_00134220.1| COG1904: Glucuronate isomerase [Actinobacillus p protmod 7 .............................................................................................................................................................................................................................................................................TAVLVWLASEYCKRNWVMQMHIGALRNNNTRMFKLLGTDAGFD-SIADLTYASQLSQLLDAMDQLPKTILYCLNPRDNEMIASMIGNFQKIQFGSGWWFNDQKDGMERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVVKGEAPNDLLGNMVKNICYHNAKSYF.. 195
66  6.000e-38 28  Brucella melitensis 16M gi|17988822||ref|NP_541455.1| URONATE ISOMERASE [Brucella melitensis 16M] gi|179 protmod 1 .............................................................................................................................................................................................................................................................................................................................................................MAPLAGHYPALKLGPAWWFFDSPEGILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLEEDEAYEVAHDLAYRLAKQTY.. 100
67  7.000e-22 37  Escherichia coli gi|606032||gb|AAA57895.1| ORF_f86; overlaps f352 by 17 bases, no frameshift foun protmod 1 ...............................................................................................................................................................................................................................................................................................................................MAEELSKLLNEENLLPKTILYCLNPRDNEVLGTMIGNFQKMQFGSGWWFNDQKDGMERQMTQLA.................................................................... 73
68  1.000e-16 39  Escherichia coli gi|606031||gb|AAA57894.1| ORF_f62; overlaps f86 by 8 bases, no frameshift found protmod 1 .........................................................................................................................................................................................................................................................................................................................................................................................................MLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAPADLLGEMVKNICFNNARDYF.. 57
69  2.000e-04 23  Trichodesmium erythraeum IMS101 gi|48893528||ref|ZP_00326764.1| COG2159: Predicted metal-dependent hydrolase of protmod 177 ................................................................................................................................................................................................................................................ELAKSQFNTI--KKNSGEKLPRLNHKSLIDFLIIQTLEIAAKYKMPIQFH------------------TGFGDPDLDLRQSNPLHRFLNRFQNTPIILLHASYP-YSREAGYLASVYPNVYFGLAI-PSLSIAGMKHVVRQLMDVAPISKLM-YSSDAHLIPDYYLGAKWGRKILAYVLEESVKDGDLTINEAEEIAVDVLRKNATDIY.. 369
70  0.002 13  Agrobacterium tumefaciens gi|6498272||dbj|BAA87724.1| tiorf99 [Agrobacterium tumefaciens] gi|10954919|ref| protmod 153 ......................................................................................................................................................................................FAAGNPDFNQIEHQL----GEKIGSLESLEAAIGTLFA-ISSRYAVAVKTQHAYARTSPRSNEDAALALQKVRQARSASEADRLCLGDWCLSRIAEQCAAHNLPWKIHTGYFAKNN--------------FMPTENLRAGNLDGLIRA-NPRTRFVLMHIAYPHSDEMIALAKHYANVSVDMCWWSINASDFLRRYMHAAPKNKLFAASVGY--------SYQCR-DWFGRT----LQKEISEGFLAENQAIDLARFFMADNPYDYY.. 403
71  0.003 16  Oryza sativa (japonica cultivar-group) gi|31432457||gb|AAP54087.1| putative glutamine synthetase [Oryza sativa (japonic protmod 72 ............................................................................................................................EASLEKVEEFRAEGLFKAANLSAI-LIDDGIDELEAHKAFAPTV--GRIL---RIEKLAEINDESFSASLDSFTEIFVTKLKSYPPHIAAYRS---------------GLEIDP--NISKTDAEDGLRKELSGQRPLRITNKNLIDYLFTCSLEIAVSYHLPMQIHTGFLRKCNPLHLRAVLEDTRF--SKCQIVLLHASYPFSKE--------ASYLASVYSQVYLDFGLAIPKL----------SVQGMTSSIKELLELAPIKK-VMFSTDGYAFETYYLGARRARDVVYRVLSAACEDGDLSIQEAIEAVEDIFRRNA...... 373



Contact us