Homologs of:

1vj1_A mol:protein-het length:363 Putative Nadph-Dependent Oxidoreductase
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350
# E-value %id Organism Protein Model Start XIIQRVVLNSRPGKNGNPVAENFRVEEFSLLDALNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQLAQVADGGGIGIVEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGXPGLTSLIGVQEKGHISAGSNQTXVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNTVISQXNENSHIILCGQISQYNKDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETVAKGLENXGVAFQSXXTGGNVGKQIVCISEDSSLEnd
6.000e-85 85  Pongo pygmaeus gi|55730768||emb|CAH92104.1| hypothetical protein [Pongo pygmaeus] protmod 2 .IVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQLSQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHLLGCSRVVGICGTHEKCVLLTSELGFDAAINYKKDNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKERNITRERFLVLNYRDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEISL 351
1.000e-84 85  Homo sapiens gi|22748929||ref|NP_689657.1| zinc binding alcohol dehydrogenase, domain contain protmod 2 .IVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQLSQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKKDNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKERNITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEISL 351
1.000e-82 97  Mus musculus gi|18204012||gb|AAH21466.1| Zadh1 protein [Mus musculus] protmod 2 .IIQRVVLNSRPGKNGNPVAENFRVEEFSLLDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGIVEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNTVISQMNENSHIILCGQISQYNKDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETVAKGLENMGVAFQSMMTGGNVGKQIVCISEDSSL 351
1.000e-81 95  Mus musculus gi|21313356||ref|NP_084156.1| zinc binding alcohol dehydrogenase, domain contain protmod 2 .IIQRVVLNSRPGKNGNTVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCISEDSSL 351
8.000e-79 76  Gallus gallus gi|50748229||ref|XP_421166.1| PREDICTED: similar to 1810016I24Rik protein [Gallu protmod 569 .IIQRVVLNSRPGKNGVPVAENFRLEQSTIPDTVQEGQVRVRTLYLSVDPYMRCRMNEDTGSDYLLPWQLSEVADGGGIGVVEESKHHNFAKGDIVTSFNWPWQTVAILDGSLLQKVVPELVNGRLSYFLGAAGLTGLTALLGIREKGHVTVGANQTMVVSGAAGACGSLAGQIGRLEGCSRVVGIAGTDEKCSILVSEMGFDAAINYKTGNVAQQLRELCPGGVDVYFDNVGGDISDTVISQMNQNSHIILCGQISQYNKDVPYPPPLPPGTEKIQKERNITRERFLVLNYMDKQEASILQLCQWIQEGKLKVRETVVEGLANIGAAFQSMMNGGNIGKQIVLVS..... 913
7.000e-76 67  Xenopus laevis gi|57032552||gb|AAH88925.1| LOC496331 protein [Xenopus laevis] protmod 3 ..IKRVVLASRPGNDREPVKENFRLEELTISEELTEGKVLARTLFLSVDPYLRCRMNEDTGTDYIGPWKISEVLDSGGIGVVEESRTSKFAAGDFITSFNWPWQTKSILNGESLIKLDPSLVDGHLSHFLGAVGLTGLTALIGVKEKGHVIPGANQTMVVSGAAGACGSLAGQIGRLLGCSRIVGICGTEQKCKLLVSDLGFDSAVNYKERGLAEKLRACCPNGVDVYFDNVGGEISDTVVCQMNQNSHIILCGQISQYNKDVPYPPPLQAETATFLKQNNITRERFMVLNYADQHESAIVQLSHWIKTGKLKVKETILHGLENTASAFLSMMAGGNVGKQIVQVSE.... 347
2.000e-73 62  Danio rerio gi|50418480||gb|AAH77125.1| Unknown (protein for IMAGE:7136226) [Danio rerio] protmod 44 ....RVVLSSRPGNNGQPVKENFRVEETTTSSELKEGQVLVRTLYLSVDPYMRCRMNDDTGADYLLPWRLEECVDGGGVGVVKASKNPDLSVGTIVTSFNWHWQTYDVMDGSLLQKVDPGMVDGHVSYFLGAVGMPGLTAFFGVREKGHVTAGAQQTMVVSGAAGACGSVAGQIGRLDGCKTVVGICGSDQKCQTLVKELGFTAGINYRNGDVSSALREHCPRGIDIYFDNVGGPISDAVISQMNPGAHVILCGQISQYNKDVPYPPPLSQDTQDALRRNNITRERFIVLNYMEKHAEGLMQLSHWVKTGQIKVLETVVNGIQNMGEAFCSMMTGGNIGKQVVKISD.... 386
2.000e-73 61  Tetraodon nigroviridis gi|47221210||emb|CAG13146.1| unnamed protein product [Tetraodon nigroviridis] protmod 3 .LVKRVVLNSRPGKDGAPEPGNFRVEETTLEPDLEDGEVLVRTLYLSVDPYMRCRMNEDTGADYLTPWQLGERVDGGGVGVVESSRCGALSVGAVVTFLNWPWQTHAVLTGTALRKVDPQLVDGHLSHFLGALGMTGLSAFFGVREEGHVTKGAKQTMVVSGAAGACGSMAGQIGRLDGCLGVVGICGSEEKCRTLLEDLGFSAAINYRTEDVPARLKACCPDGVDVYFDNVGGAISDAVISQMNPGGHVILCGQISQYNKDVPYPPPLSQEIQEVLRGRNITRERFVVLRYTDRLDEALCELSRWLRSGQIKVLETVINGIEKMGDAFCSMMEGGNVGKQIVKISE.... 348
8.000e-73 96  Mus musculus gi|26331198||dbj|BAC29329.1| unnamed protein product [Mus musculus] protmod 2 .IIQRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKL....................................... 312
10  6.000e-70 37  Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150 gi|56413465||ref|YP_150540.1| putative NADP-dependent oxidoreductase [Salmonella protmod 19 ..NRRWVLASRP--HGAPQMDNFRLEEDDVA-TPGEGQVLLRTVFLSLDPYMRGRMSDEP--SYAPPVEPGCVMVGGTVSRVVASNHPDYRPDEWVLS-YNGWQDYDISDGEGLVKLGDN--PQHPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGIAGGAEKCRHATDVLGFDLCLDHHADNFPQQLAQACPQGIDIYYENVGGKVFDAVLPLLNTSARIPLCGLVSGYNATLPDGPDRLPLLMATLLKKRIRLQGFIINDYGHRIHEFQQEMGRWIKEGKIHYREQITDGLENAPEAFIGLLAGKNFGKVVIRLADDA.. 356
11  8.000e-70 37  Salmonella typhimurium LT2 gi|16420113||gb|AAL20507.1| putative NADP-dependent oxidoreductase [Salmonella t protmod 19 ..NRRWVLASRP--HGAPQMDNFRLEEDDVA-TPGEGQVLLRTVFLSLDPYMRGRMSDEP--SYAPPVEPGCVMVGGTVSRVVASNHPDYRPDEWVLS-YNGWQDYDISDGEGLVKLGDN--PQHPSWSLGILGMPGFTAYMGLLDIGQPKEG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGIAGGAEKCRHATDVLGFDLCLDHHADNFPQQLAQACPQGIDIYYENVGGKVFDAVLPLLNTSARIPLCGLVSGYNATLPDGPDRLPLLMATLLKKRIRLQGFIINDYGHRIHEFQQEMGRWIKEGKIHYREQITDGLENAPEAFMGLLAGKNFGKVVIRLADDA.. 356
12  1.000e-69 37  Shigella flexneri 2a str. 301 gi|24113120||ref|NP_707630.1| putative oxidoreductase [Shigella flexneri 2a str. protmod 39 ..NRRWVLPSRP--HGAPVPENFRLEEDDVA-TPGEGQVLLRTVYLSLDPYMRGRMSDEP--SYSPPVDIGGVMVGGTVSRVVESNHPDYQPGDWVLG-YSGWQDYDISSGDDLVKL--GDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATEPVGATVGQIGKLKGC-RVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIYYENVGGKVFDAVLPLLNTSARIPVCGLVSSYNAELPPGPDRLPLLMATVLKKRIRLQGFIIADYGHRIHEFQKEMGQWVKEDKIHYREDITDGLENAPQTFIGLLKGKNFGKVVIRVAGDDK. 377
13  1.000e-69 37  Salmonella enterica subsp. enterica serovar Typhi Ty2 gi|29141943||ref|NP_805285.1| putative NADP-dependent oxidoreductase [Salmonella protmod 8 ..NRRWVLASRP--HGAPQMDNFRLEEDDVA-TPGEGQVLLRTVFLSLDPYMRGRMSDEP--SYAPPVEPGCVMVGGTVSRVVASNHPDYRPDEWVLS-YNGWQDYDISDGEGLVKLGDN--PQHPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGIAGGAEKCRHATDVLGFDLCLDHHADNFPQQLAQACPQGIDIYYENVGGKVFDAVLPLLNTSARIPLCGLVSGYNATLPDGPDRLPLLMATLLKKRIRLQGFIINDYGHRIHEFQQEMGRWIKEGKIHYREQITDGLENAPEAFIGLLAGKNFGKVVIRLADDA.. 345
14  2.000e-69 37  Shigella flexneri 2a str. 2457T gi|30063238||ref|NP_837409.1| putative oxidoreductase [Shigella flexneri 2a str. protmod 39 ..NRRWVLASRP--HGAPVPENFRLEEDDVA-TPGEGQVLLRTVYLSLDPYMRGRMSDEP--SYSPPVDIGGVMVGGTVSRVVESNHPDYQPGDWVLG-YSGWQDYDISSGDDLVKL--GDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATEPVGATVGQIGKLKGC-RVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIYYENVGGKVFDAVLPLLNTSARIPVCGLVSSYNAELPPGPDRLPLLMATVLKKRIRLQGFIIADYGHRIHEFQKEMGQWVKEDKIHYREDITDGLENAPQTFIGLLKGKNFGKVVIRVAGDD.. 376
15  3.000e-69 37  Escherichia coli K12 gi|1787721||gb|AAC74531.1| putative oxidoreductase; putative dehydrogenase, NAD( protmod 39 ..NRRWVLASRP--HGAPVPENFRLEEDDVA-TPGEGQVLLRTVYLSLDPYMRGRMSDEP--SYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLG-YSGWQDYDISSGDDLVKL--GDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIYYENVGGKVFDAVLPLLNTSARIPVCGLVSSYNAELPPGPDRLPLLMATVLKKRIRLQGFIIADYGHRIHEFQREMGQWVKEDKIHYREEITDGLENAPQTFIGLLKGKNFGKVVIRVAGDD.. 376
16  4.000e-69 42  Bacillus licheniformis ATCC 14580 gi|52079210||ref|YP_078001.1| putative oxidoreductase [Bacillus licheniformis AT protmod 4 ...KQIELARRP--QGIPVMDDFRIKETEIPEA-KNGEALVKTLYVSVDPYMRGRMQDT--KSYVEPFPLDEVITGGVIGEVISAKGDKLKKGDIVLGRL-GWQEYSAVREDNLQKIDPSLAPVTA--FLGILGMTGLTAYFGLLDIGQPKAG--ETVVVSGAAGAVGSAVGQIAKIKGA-RVVGIAGSDEKTAYLKEKLGFDEAINYKTENMASALEQACPDGVDVYFDNVGGAISDAVFTLINKFARIPVCGAISSYNVKSAEEDMGPRVQTALIKSSAL-MKGFVVNDYRDRFPEGIKQLAEWVKSGQLQYEETITEGFERIPEAFLGLFEGKNLGKQLIKVADSD.. 338
17  4.000e-69 37  Escherichia coli O157:H7 gi|12515250||gb|AAG56326.1| putative oxidoreductase [Escherichia coli O157:H7 ED protmod 39 ..NRRWVLASRP--HGAPVPENFRLEEDDVA-TPGEGQVLLRTVYLSLDPYMRGRMSDEP--SYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLG-YSGWQDYDISSGDDLVKL--GDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIYYENVGGKVFDAVLPLLNTSARIPVCGLVSSYNAELPPGPDRLPLLMATVLKKRIRLQGFIIADYGHRIHEFQREMGQWVKEDKIHYREEITDGLENAPQTFIGLLKGKNFGKVVIRVAGDD.. 376
18  8.000e-69 41  Streptomyces coelicolor A3(2) gi|6562798||emb|CAB62729.1| putative oxidoreductase [Streptomyces coelicolor A3( protmod 34 .VNREWHLVTRP--VGWPKPEDFALVEAEV-PTPGDGQVLVRNLYVSVDPYMRGRMS--AAKSYAAPYELGKPMLGGAVGEVVASNAEGIAVGDHVLHFL-GWREYAAVDAKSAVKVDPDA--APLSTYLGVLGMTGLTAYAGLLRTASFKEGDSV--FVSGAAGAVGSQVGQIAKLKGASRVIGSAGSDEKVKLLLDEYGFDAAFNYKNGPVSEQLRAAAPDGVDVYFDNVGGDHLEAAIGSLNLNGRIAICGAISVYNNTEPAPGPK---NLARLIQTRGRIEGFLVGDHYDLQPKFVEEVGPWVRTGELKYRETVVEGIENNLEAFLGVLRGDNTGKMIVKL...... 364
19  2.000e-68 37  Escherichia coli O157:H7 gi|38703978||ref|NP_310080.2| putative oxidoreductase [Escherichia coli O157:H7] protmod 16 ..NRRWVLASRP--HGAPVPENFRLEEDDVA-TPGEGQVLLRTVYLSLDPYMRGRMSDEP--SYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLG-YSGWQDYDISSGDDLVKL--GDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIYYENVGGKVFDAVLPLLNTSARIPVCGLVSSYNAELPPGPDRLPLLMATVLKKRIRLQGFIIADYGHRIHEFQREMGQWVKEDKIHYREEITDGLENAPQTFIGLLKGKNFGKVVIRVAGDD.. 353
20  3.000e-68 38  Bradyrhizobium japonicum USDA 110 gi|27379084||ref|NP_770613.1| probable NADP-dependent oxidoreductase [Bradyrhizo protmod 15 ..AKRIVLAARP--VGEPKPSDFRIEEFAV-PTPGQGEVLLRTIWLSLDPYMRGRMSD--GPSYAAPVPIDGVMEGEAVSEVAASNNPDFAKGDIVRAR-TGWQTHAISSGKGLIKVDPKLGP--ISTSIGVLGMPGMTAYTGLLDIGKPQEG--ETVVVAGASGAVGSAVGQIAKIKGA-RAVGIAGGKDKCDYVVKELGFDACIDHRDPDLAAKLKDACPKGIDVYFENVGGAVFEAVFPLLNPFARVPVCGLIAHYNDTEAKPPKWAASMMRATLTKRLTFRGFIVSDFAARHGDFLRDMSAWVREGKVKYKEFVTEGLESAPGAFMGLLKGANFGKQLVRVGQDKA. 351
21  4.000e-68 38  synthetic construct gi|49087192||gb|AAT51427.1| PA2197 [synthetic construct] protmod 7 .VNRRIVLASRP--HGAPTRDNFRIEQVPLPEP-GAGQVLLRTVYLSLDPYMRGRMSD--APSYAPPVELGAVMVGGTVSRVEASNHPGFKVGDWVLSAN-GWQDYALSDGSGLARL--GESPEHPSYALGLLGMPGFTAYMGLLDIGKPQAG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRHAVQVLGFDACLDHHAADFAERLAEACPDGIDIYYENVGGKVFDAVFPLLNAKARIPVCGIVAHYNDELPPGPDRLPALMGTILRKRIKVQGFIIFDYGHRYDEFQRDMSKWFADGLIQYREERVDGLENAPEAFFGLLQGRNFGKLVVRVGADAG. 346
22  5.000e-68 38  Pseudomonas aeruginosa PAO1 gi|9948219||gb|AAG05585.1| conserved hypothetical protein [Pseudomonas aeruginos protmod 7 .VNRRIVLASRP--HGAPTRDNFRIEQVPLPEP-GAGQVLLRTVYLSLDPYMRGRMSD--APSYAPPVELGAVMVGGTVSRVEASNHPGFKVGDWVLSAN-GWQDYALSDGSGLARL--GESPEHPSYALGLLGMPGFTAYMGLLDIGKPQAG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRHAVQVLGFDACLDHHAADFAERLAEACPDGIDIYYENVGGKVFDAVFPLLNAKARIPVCGIVAHYNDELPPGPDRLPALMGTILRKRIKVQGFIIFDYGHRYDEFQRDMSKWFADGLIQYREERVDGLENAPEAFFGLLQGRNFGKLVVRVGADA.. 345
23  6.000e-68 38  Pseudomonas aeruginosa UCBPP-PA14 gi|32042299||ref|ZP_00139882.1| COG2130: Putative NADP-dependent oxidoreductases protmod 7 .VNRRIVLASRP--HGAPTRDNFRIEQVPLPEP-GAGQVLLRTVYLSLDPYMRGRMSD--APSYAPPVELGAVMVGGTVSRVEASNHPGFKVGDWVLSAN-GWQDYALSDGSGLARL--GESPEHPSYALGLLGMPGFTAYMGLLDIGKPQAG--ETLVVGAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRHAVQVLGFDACLDHHAADFAERLAEACPDGIDIYYENVGGKVFDAVFPLLNAKARIPVCGIVAHYNDDLPPGPDRLPALMGTILRKRIKVQGFIIFDYGHRYDEFQRDMSKWFADGLIQYREERVDGLENAPEAFFGLLQGRNFGKLVVRVGADA.. 345
24  2.000e-67 36  Vibrio parahaemolyticus RIMD 2210633 gi|28901271||ref|NP_800926.1| putative oxidoreductase [Vibrio parahaemolyticus R protmod 6 ..NRRIVLASRP--HGAPTTENFRLEEVA-KPVPQAGEMLLRTVYLSLDPYMRGRMSD--AESYAEPVALDDVMIGGTVCQVEASNHPDYEAGEWVLAYTVGWQDYAISTGEMVIKLGKE--PQNPSYALGVAGMPGFTAYMGLLDIGQPKPG--ETIVVAAATGPVGATVGQIGKIKDC-RVVGIAGGEEKCRYAKEVLGFDECIDHKADDFEQQLKDACYNGIDVYFENVGGKVFEAVMPLLNTSARIPLCGLISQYNAELPEGTDHLPLLMGKLLTKRIKVQGFIIFDYGHRYGEFAQDINQWLAEGKIQYREHLVEGLDNAPEAFIGLLEGKNFGKLVVKINDP... 343
25  2.000e-67 41  Bacillus subtilis subsp. subtilis str. 168 gi|16077812||ref|NP_388626.1| hypothetical protein BSU07450 [Bacillus subtilis s protmod 6 ...QQIQLARRP--QGIPVHEDFRFETIPVPEP-KQGEVLVKTLYVSVDPYMRGRMQDT--KSYVEPFALDKALSGGVIAEVVSDGN-HLKKGDIVIGNL-SWQEFSAVSESALRKIDTSL--APASAYLGILGMTGLTAYFGLLDIGRPKEG--ETVVVSGAAGAVGSTVGQIAKIKGA-RVVGIAGSDEKIDYLKQELQFDEAINYKTDDIQKALQNACPDGVDVYFDNVGGPISDAVMNLLNEFARIPVCGAISSYNAESEADDMGPRVQSKLIKTKSL-MQGFIVSDYSDRFSEGAKQLAEWLKAGKLHYEETITEGFENIPDAFLGLFKGENKGKQLIKVSDPS.. 339
26  2.000e-67 39  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50119403||ref|YP_048570.1| putative zinc-binding dehydrogenase [Erwinia carot protmod 7 .INRRVVLAQRP--HGAPTQDNFRLEQQAV-PSVDSGQVLLRTVFLSLDPYMRGRMSD--APSYAKPVELNDVMVGGTISRVVESKHPDYQTGDWVLS-YSGWQDYAISDGKGLTNL--GQSPTNPSYALGILGMPGFTAYMGLTDIGQPKAG--ETLVVAAATGPVGATVGQIGKLKGC-RVVGVAGGAEKCRYAVEVLGFDVCLDHRADDFAEQLKQACPQGIDIYFENVGGKVFDAVLPLLNTSARIPVCGLVSGYNGTLPDGPDRLPLLAGTLLKKRIRMQGFIIFDYGHRFDEFWKEVSPWVAQGKIKYREEIVDGLENASEAFIGLLHGRNFGKLVIRIGPDA.. 345
27  3.000e-67 38  Nostoc punctiforme PCC 73102 gi|23125636||ref|ZP_00107560.1| COG2130: Putative NADP-dependent oxidoreductases protmod 5 .INRQFLLAARP--VGDIKESDFEYRE-EPIPSPKDDEVLVRTIYLSLDPTNRIWMSDME--QYMPPVEIGEVMRGGIIGVVEESKNPNFKKGDLVSGLL-GWQDYAIASGFSLTRLPNPL-PCPLNAFTGPLGATGFTAYFGLLDIGQPKVG--ETVVVSAAGGAVGSIVGQIAKIKGC-RVVGITGSDEKCRWLTEELGFDAAINYKTGDLEKALAQACPNGIDVYFDNVGGIILDAVLTKINLRARLPLCGLISTYNASKPVPGPYNYSQILM---KRALVQGFIILDYIPRFHEAIAEIGKWLNQGQIKYALEIVEGLENAPKAILKLFDGNKKGKLVIKVSNE... 341
28  3.000e-67 39  Burkholderia fungorum LB400 gi|48783915||ref|ZP_00280296.1| COG2130: Putative NADP-dependent oxidoreductases protmod 9 .INRQLVLASRP--QGAVTPDNFRLVEAPLAP-LADGELRVRNHYLSLDPYMRGRMNDS--KSYAPPQPLNEVMIGGTVGEVVESKNPKFAVGDKVVAMF-GWQEYGTSNGTGLQKVDDTHVP--LSAYLGPVGMPGVTAWYGLNRIIAPKAG--ETVVVSAASGAVGSVVGQLAKLAGA-RAVGIAGGADKCRYVTGTLGFDACVDYKAGNLYQDLKAATPNGVDGYFENVGGEVLDATLARMNPFGRIALCGFIAGYDGQ-----PVPLRHPSLMLTQRLLVQGFIVSEHMDVWPEALKRLGTLVAQKKLHYRETIAQGLDAAPEAFMGLLKGKNFGKQLVKL...... 336
29  4.000e-67 40  Pseudomonas syringae pv. tomato str. DC3000 gi|28852474||gb|AAO55547.1| oxidoreductase, zinc-binding [Pseudomonas syringae p protmod 57 ..NRQFLLAKRPS--GAVRRDDFTYQQVPV-TSLADGQILVRNKFLSLDPAMRGWMND--GKSYIPAVQLGEVMRALGVGEVLESKNPKFAAGDHVQGALGT-QDYFAGEPKGFYKVDTSLAPLPL--YLSALGMTGMTAYLALLDVGQPKSGD--TVLISGAAGAVGSIAGQIAKLKGC-RVVGIAGGKDKCSLLTSELGFDAAIDYKSEDVMDAIKRHCPDGVNVYFDNVGGDILDAALSQLAVGARVVICGAISQYNNTTAIKGPANYMSLLV---NRARMEGFIVLDHADRFAEAGQVMAGWIKEGKLKSKEHIVEGLETFPETFQMLFNGENQGKLILKV...... 385
30  1.000e-66 37  Vibrio vulnificus CMCP6 gi|27366940||ref|NP_762467.1| Putative NADP-dependent oxidoreductase [Vibrio vul protmod 6 ..NRQIVLASRP--VGAPTADNFALTQSDI-PTPAQGEMLLRSVYLSLDPYMRGRMSD--AKSYAEPVGIDEVMVGGTVCQVEASNHAEFEVGEWVLA-YTGWQDYALSDGEGLIKL--GKQPSHPSYALGVMGMPGFTAYMGLLDIGQPKEGD--TLVVAAATGAVGSMVGQIGKLKGC-RVIGIAGGEEKCQFAKETLGFDECIDHKATDFAEQLAKVCHNGIDIYFENVGGKVFDAVMPLLNTGARIPLCGLISQYNATLPEGPDRMSMLMAQLLIKRIKMQGFIIFDYGHRYGEFAADMTQWLAQGKIHYREHLVQGLENAPDAFIGLLEGKNFGKMVVQTNQP... 342
31  2.000e-66 39  Pseudomonas fluorescens PfO-1 gi|48731926||ref|ZP_00265670.1| COG2130: Putative NADP-dependent oxidoreductases protmod 7 .LNQRFVLASRP--VGAPTPENFRL-EREALPDLEDGQVLLKTLYLSLDPYMRGRMSD--APSYAAPVQIGEVMTGGAVSRVEQSRHPKFHPGDLVVGA-TGWQSHSISDGRNIIPIPSGLP--SPSMALGVLGMPGMTAYMGLMDIGQPKEG--ETLVVAAASGAVGSVVGQVAKIKGL-RAVGVAGGAEKCKYVVEELGFDACIDHKAPDFAEQLAKACPDGIDIYYENVGGHVFDAVVPLLNSKARIPLCGLIAGYNAEAPKGPDRLPALQRTLLTKRVRIQGFIVFDYGDRQPEFISAMVPWVRDGKVKFREDVVEGLEQAPQAFIGLLEGRNFGKLVVKVAQD... 344
32  3.000e-66 37  Vibrio vulnificus YJ016 gi|37676717||ref|NP_937113.1| putative NADP-dependent oxidoreductase [Vibrio vul protmod 6 ..NRQIVLASRP--VGAPTADNFVLTQSDI-PTPAQGEMLLRSVYLSLDPYMRGRMSD--AKSYAEPVGIDEVMVGGTVCQVEASNHAEFEVGEWVLA-YTGWQDYALSNGEGLIKL--GKQPSHPSYALGVMGMPGFTAYMGLLDIGQPKEGD--TLVVAAATGAVGSMVGQIGKLKGC-RVIGIAGGEEKCQFAKDTLGFDECIDHKAADFAEQLAKACHNGIDIYFENVGGKVFDAVMPLLNTGARIPLCGLISQYNATLPEGPDRMSMLMAQLLIKRIKMQGFIIFDYGHRYGEFAADMTQWLAQGKIHYREHLVQGLENAPDAFIGLLEGKNFGKMVVQTNQP... 342
33  4.000e-66 41  Streptomyces avermitilis MA-4680 gi|29609438||dbj|BAC73488.1| putative dehydrogenase [Streptomyces avermitilis MA protmod 10 .VSREWHLASRP--VGWPKPEDFALVEAEV-QQPGEGQVLVRNKFVSVDPYMRGRMS--AAKSYVAPFELNQPMQGGAVGEVVVSNAEGIEAGDHVLHFL-GWREYAVVDAKQAVKVDPEA--APLSAYLGVLGMTGLTAYAGLLRTASFKEGDSV--FVSGAAGAVGSQVGQIAKLKGASRVIGSAGSDDKVKLLVEEYGFDAAFNYKSGPVNEQLREAAPDGVDVYFDNVGGDHLEAAIGQLNRDGRIAVCGMISVYNDTEPAPGPK---NLARLIQTRGRIQGFLVGDHYDLQSQFVQEVGGWIRSGELKYRETVVEGIENNLEAFLGVLRGDNTGKMIVKL...... 340
34  1.000e-65 32  Rhodopirellula baltica SH 1 gi|32476719||ref|NP_869713.1| putative oxidoreductase [Rhodopirellula baltica SH protmod 12 ...KQIELVSRP--DGMPQPSNFELRKAEVGP-IQDGEILVKNQWMSVDPYMRGRMKDTD--SYVPPFQIDEPLEGGCIGEVVQSENDQFKEGDMVLGNL-GWREYWTSDGKGITKIDPNIAPPQA--FLGALGMTGMTAWVGLHKIARLKKGS--TVFVSAASGAVGSIVCQLAKAMDC-RVIGSAGKEEKIQWLKDKTGIDAVINYKEVDLSEELAKHAPDGIDVYFDNVGSDHLEAAIDNMNDFGCCVECGMIATYNATEP---PAAPRNMFKVIAKRLRIQGFIVRDHMDAKDEFVADMAKLIQQDKVVWEESVTDGIENAPDAFIGLFEGDNLGKQLVRLN..... 341
35  1.000e-65 39  Rhodopseudomonas palustris CGA009 gi|39935270||ref|NP_947546.1| quinone oxidoreductase [Rhodopseudomonas palustris protmod 5 ...QRIVLASRP--VGEPTPQNFRLEEFDV-PAPGEGQVLLRTIWLSLDPYMRGRMSD--GPSYAQPVPVGGVMEGGTVCEVIDSKSPGFAKGDIVLA-HSGWATHAIADAKPLRKIDPALGP--ISTAVGVLGMPGMTAYTGLLDIGQPKEG--ETVVVAAASGAVGSAVGQIAKVKGA-RAIGIAGGKDKCDYVKQELGFDDCLDHRDPDLAAKLKAACPNGIDVYFENVGGEVFEAVFPLLNAFARIPVCGLIAQYNAETPPTPKWATALMRHVLTKRLTIRGFIVSDFAGRRQEFLREMSGWVRDGKVKYREHVTDGLENAPEAFMGLLKGANFGKQLVRVGPERA. 341
36  1.000e-65 41  Pseudomonas syringae pv. syringae B728a gi|23469081||ref|ZP_00124416.1| COG2130: Putative NADP-dependent oxidoreductases protmod 6 ..NRQFLLAKRPS--GDARREDFTYQEVPVS-ALADGQILVRSKYLSLDPAMRGWMNE--GKSYIPAVELGEVMRAIGVGEVIESKNPKFAVGDHVQGRL-GVQDYFAGEPKGFYKVDTNLAPLPL--YLSALGMTGMTAYLALLDVGQPKSGD--TVVISGAAGAVGSIAGQIAKLKGC-RVVGIAGGTKKCRLLTEELGFDAAIDYKSEDVMDGLKRHCPDGVNVYFDNVGGDILDAALSQLAVGARVVICGAISQYNSTKAIKGPANYMSLLV---NRARMEGFIVLDHPERYAEAGQVMAGWIKEGKLKSKEHIVEGLETFPETFQMLFSGENQGKLILKV...... 334
37  2.000e-65 39  Pseudomonas putida KT2440 gi|26988546||ref|NP_743971.1| alcohol dehydrogenase, zinc-containing [Pseudomona protmod 5 ..NRRFLLAKRP--VGAVRRDDFSFETVP-AEQPGEGQVLVRNLYLSLDPAMRGWMNE--GKSYIPPVALGQVMRALGVGEVVASNHPGYQPGDHVSGAL-GVQDYFTGEPQGLHKIDPKLAPLP--RYLSALGMTGMTAYFALLEVGQPKAGD--TVVISGAAGAVGSIVGQIAKIKGC-RVVGIAGGAEKCQYLKDELGFDGVIDYKAEDVLAGLKRECPKGVDVYFDNVGGDILDAVLTRINFKARIVICGAISQYNNKEAVKGP---ANYLSLLVNRARMEGFVVMDYTKDYGKAAQEIAGWLANGQVKSKEDVVEGLETFPETLLKLFSGENFGKLVLKV...... 333
38  3.000e-65 59  Tetraodon nigroviridis gi|47221207||emb|CAG13143.1| unnamed protein product [Tetraodon nigroviridis] protmod 3 .LVKRVVLNSRPGKDGAPEPGNFRVEETTLEPDLEDGEVLVRTLYLSVDPYMRCRMNEDTGADYLTPWQLGERVDGGGVGVVESSRCGALSVGAVVTFLNWPWQTHAVLPGTALRKVDPQLVDGHLSHFLGALGMTGLTAFFGVREQGHVTKGAKQTMVVSGAAGACGSMAGQIGRLDGCLGVVGICGSEEKCRTLLEDLGFSAAINYRTEDVPARLKACCPDGVDVYFDNVGGAISDAVISQ------------ISQYNKDVPYPPPLSQEIQEVLRGRNITRERFVVLRYTDRLDEALCELSRWLRSGQIKVLETVINGIEKLPDAFCSMMEGGNVGKQIVKISE.... 359
39  5.000e-65 38  Pseudomonas aeruginosa UCBPP-PA14 gi|53727809||ref|ZP_00139277.2| COG2130: Putative NADP-dependent oxidoreductases protmod 5 .INRQYQLAQRPS--GLPGRDTFSFVETPLGEP-AEGQILVKNEYLSLDPAMRGWMND--ARSYIPPVGIGEVMRALGVGKVLVSKHPGFQAGDYVNGAL-GVQDYFVGEPKGFYKVDPSRAPLP--RYLSALGMTGMTAYFALLDVGQPKNG--ETVVISGAAGAVGSVAGQIARLKGC-RVVGIAGGAEKCRFLVEELGFDGAIDYKNEDLAAGLKRECPKGIDVFFDNVGGEILDTVLTRIAFKARIVLCGAISQYNNKEAVRGP---ANYLSLLVNRARMEGMVVMDYAQRFPEGLKEMATWLAEGKLQSREDIVEGLETFPETLLKLFSGENFGKLVLKV...... 334
40  6.000e-65 38  Pseudomonas aeruginosa PAO1 gi|9947617||gb|AAG05037.1| probable oxidoreductase [Pseudomonas aeruginosa PAO1] protmod 5 .INRQYQLAQRPS--GLPGRDTFSFVETPLGEP-AEGQILVKNEYLSLDPAMRGWMND--ARSYIPPVGIGEVMRALGVGKVLVSKHPGFQAGDYVNGAL-GVQDYFIGEPKGFYKVDPSRAPLP--RYLSALGMTGMTAYFALLDVGQPKNG--ETVVISGAAGAVGSVAGQIARLKGC-RVVGIAGGAEKCRFLVEELGFDGAIDYKNEDLAAGLKRECPKGIDVFFDNVGGEILDTVLTRIAFKARIVLCGAISQYNNKEAVRGP---ANYLSLLVNRARMEGMVVMDYAQRFPEGLKEMATWLAEGKLQSREDIVEGLETFPETLLKLFSGENFGKLVLKV...... 334
41  1.000e-64 39  Pseudomonas putida KT2440 gi|26989199||ref|NP_744624.1| alcohol dehydrogenase, zinc-containing [Pseudomona protmod 7 .INRRVVLASRP--HGAPLEANFRIEQSPIPEP-AEGQVLLRTVYLSLDPYMRGRMSD--APSYAAPVEIGGVIVGGTVCRVEASKNPAYKVGDWVLSF-AGWQDYTLSDGSDLTAL--GESPAHPSYALGIFGMPGFTAYMGLLDIGRPQAG--ETLVVAAATGPVGATVGQIGKIKGC-HVVGVAGGAEKCRHAVEVLGFDACLDHRAPDFAEQLAKACPAGIDIYFENVGGKVFDAVLPLLNTKARVPVCGIIAHYNDTLPNGPDRLPALMGSILRKRIHVQGFIIFDYGHRYNEFFNDMSSWFAQGRIKYREELVSGLEEAPKAFIGLLEGRNFGKLVVRVSED... 344
42  2.000e-64 40  Ralstonia eutropha JMP134 gi|46132192||ref|ZP_00170602.2| COG2130: Putative NADP-dependent oxidoreductases protmod 7 ...KRIVLASRP--EGAVTPANFRLEEVPVPE-LADGQVLVRNHYLSLDPYMRGRMNDS--KSYATPQPLNEVMIGGTVGEVVASKNSKYKAGDKVVGMF-GWQEMGVSDGTGMQPVDTTHIP--LSAYLGSVGMPGVTAWYGLNKIIQPKAG--QTVVVSAASGAVGSVVGQLAKLAGC-RAVGFAGGKDKCDYVVNELGFDACIDYKSKELYTMLKEATPNGIDGYFENVGGDILDAVLTRMNAFGRIAMCGMIAGYDGQ-----PLPLKNPQLILVSRLTVEGFIVSEHMEVWPQALKELGTAVAQGKLKFRESVAQGLESAPEAFMGLLKGKNFGKQLVKL...... 336
43  6.000e-64 40  Oceanobacillus iheyensis HTE831 gi|23100402||ref|NP_693869.1| quinone oxidoreductase [Oceanobacillus iheyensis H protmod 5 ..NQQIKLTKRP--EGTPTNEHFEIVDIPI-NNPNDGEVLIKTIYLSVDPYMRGRMS--AGKSYVKPFEVDKPMNGTIVGEVVTSESESFSKGDLVRGML-PWQRYNVVSASYVEKIDPSV--APLTAYLSVLGLTGLTAYFGLLDIGQPKEG--ETVVVSAAAGAVGSSVGQIAKIKGA-HVVGIAGTDEKIDYLENQLGFDKAVNYKDADFKQQLKEACPNGVDVYFDNVGGEVTDNVISLLNDFARIPLCGAISTYN--LKPGEDHGPSILPKILKTRTTMKGFIVSDYQEQFPEAIKDLAKWVAEDKLSYEVTTVDGFENTPTAFLDLFEGKNKGKQLVKVSEISS. 339
44  2.000e-63 35  Photobacterium profundum SS9 gi|54302837||ref|YP_132830.1| hypothetical alcohol dehydrogenase, zinc-containin protmod 1 .MNQEIQLASRP--TGIPSAENFALAQNTLPE-IQDGEVLVKNLWMSVDPYMRGRMMDRA--SYIAPFQIGEALEGGAIGEVIESKNTEFPAGTKVNSMQ-GWRSHYISNGNGLTALPVTPLPDQ--SFLGIMGMPGMTAWTGLFRIANLKP--TDTVFISAASGAVGSVACQIAKMHGCT--VVGSTGSDDKVALLKSLGVDVVINYKKENLTEALAKAAPQGIDVYFENVGGEHLEAALANMSDYGRIAVCGMISQYNATEPQPGP---TNLAMLIIKKLKVEGFIVFDHWAHYGEFAQQMGQWIAEGKIKWEETVYEGLAEAPNAFIGLFEGKNKGKMLVKL...... 331
45  2.000e-62 37  Burkholderia cepacia R18194 gi|46312287||ref|ZP_00212885.1| COG2130: Putative NADP-dependent oxidoreductases protmod 1 .MNRQLLLKTRP--EGRVGREHFSLVETPV-PALADGEVLVRVLYLSMDPTNRVWMSD--VPQYLPPVAIGEVMRALGIGRVVASRNAGFAEGDLVQGLV-GWQDYAVVPADQAAQLVPAASGLPLPTLLGACGMSGLTAYYGLTDITPVQPG--ETLVVSAAAGSVGSIAGQIGKIHGA-RVVGIAGGADKCRYLTETLGFDAAVDYKADDFRQQLKAATPDGVHVNFENVGGEVMRAVLSRMVIGGRVALCGVISNYNS------GRAADDVGVLISKRLTMRGFLILDYRKSRE-AVQTLAGWLRDGRLKAEETVADGLENAPDVLNRLFDGDHRGKLVLRVDPDA.. 334
46  2.000e-62 40  Ralstonia solanacearum gi|17428783||emb|CAD15468.1| PROBABLE NADP-DEPENDENT OXIDOREDUCTASE OXIDOREDUCTA protmod 6 ...QRIVLASRP--EGAVTPDNFRLETAQIPE-LQDGQVLVRNHFLSLDPYMRGRMNDS--KSYAQPQPLGEVMIGGTVGVVEASRNPAYAVGDNVVGMF-GWQEVGISDGRGMQKVDTRHVP--LSAYLGSVGMPGVTAWYGLNRIMHPKPG--QTVAVSAASGAVGSVVGQLAKLKGC-RAVGFAGGKDKCDYVVNELGFDACIDYKAKELYAMLKEATPDGIDAYFENVGGDILDAVLRRMNPFGRIAMCGMIAGYDGQ-----PLPLQNPQLILVSRLTVEGFIVSEHMDVWPEALRELGGSVAQGKLKFRESVAQGLASAPEAFIGLLKGKNFGKQLVKL...... 335
47  3.000e-62 32  Nicotiana tabacum gi|6692816||dbj|BAA89423.1| allyl alcohol dehydrogenase [Nicotiana tabacum] protmod 7 ..NKQVILKN--YVTGYPKESDMEIKNVTIKVPEGSNDVVVKNLYLSCDPYMRSRMRKIEG-SYVESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGM-TGWEEYSIIPTQTLFKIHDK--DVPLSYYTGILGMPGMTAYAGFHEVCSPKKG--ETVFVSAASGAVGQLVGQFAKMLGCY-VVGSAGSKEKVDLLKSKFGFDEAFNYKEEDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFC----LITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSRE... 343
48  4.000e-62 34  Xanthomonas axonopodis pv. citri str. 306 gi|21106355||gb|AAM35179.1| quinone oxidoreductase [Xanthomonas axonopodis pv. c protmod 5 .INRRIVLASRP--HGEPSADNFRIEEVPVAPT-GHDQILVRNRFLSLDPYMRGRMDE--GPSYAAPVAIDAVMEGGTVGEVIASNHADYHPGDLLV-LPGGWQAHSLLTPTTPLRKLPKDDSLPPSTALGVYGMPGFTAYAGLHEIGKPQPG--ETLVVAAASGPVGATVAQLARLQGL-RVVAIAGGAEKVRYLRDTLHVDVALDHRADDFAEQLRAATPNGIDIYFENVGGKVFDAVLPQLNEFARIPVCGVIATYNGQAHPGPDRLPDFMGQVLRKRLTVRGFIQHDFIRLMPAFLREMGQWLREDKIQYREHVLHGLDSAPQGLIDVLRGKNFGKAVVALA..... 342
49  2.000e-61 44  Caenorhabditis elegans gi|3878713||emb|CAA87050.1| Hypothetical protein M106.3 [Caenorhabditis elegans] protmod 24 ..NKVVIFVKRPGENNAPTIDCFDVVPIDSPKDITSDQCIVRTLFLSVDPAQRCRMNPSTGVDYLGPYEIGEPVDGEGVGVVERVGSATLEVGDLVTGCLWTWTKYFVCDSSDLVKVNPSSRNFSPSVILSCAGLSGITALLGIRKKALIDRSRPQTIVVSGAAGSCGSLAGQIARIEGCSKVIGICGSDDKCTVLKREFGFNDTINYKTENVSERLGHLAPEGIDIYWDNVGGVISDDVIRAMNNEGRVVLCGQIAVYNTDLPYPPPLPEHTTKIIKERNIQRERYLVLMYKDEIDEAVAQLSEWLQQDKIKVKETIYDGLNAAPSAFVDMMNGKNIGKMLIHFSHYEKL 379
50  2.000e-61 35  Aspergillus nidulans FGSC A4 gi|40739026||gb|EAA58216.1| hypothetical protein AN6817.2 [Aspergillus nidulans protmod 3 ..NKQIILHERPTDAIDPTSGTFRLRTVPRPDNVPADKVLVRVHYLSLDPAMRQWLS--ASRSYIAPVKIGAVMRGVSMSRVVAVGASKFQVGDWVSA-YTGWQEYAVLGKDDVEKIAIPVGGRP-TDVLSVLGLTGLTAYFGMIEIGQPRPGD--TVVVSGAAGATGMVAGQIAKIKGAKRVIGLAGTQDKCDFLVKELGFDVAINYKSPNWRKQLKAATPDYINVYFDNVGGEILDACLARAAPFSRFVMCGAISQYNTSKPKGPASYMNV----ISQRVTMKGFIVFDFAEKYAAAREELSSWLAQGKLARKDHITGGLESAPKALVDLYAGANTGKMMVEVAP.... 343
51  2.000e-61 38  Nostoc punctiforme PCC 73102 gi|23124453||ref|ZP_00106441.1| COG2130: Putative NADP-dependent oxidoreductases protmod 5 .MNKQIILKSRP--VGEPKESDFALVETPTPEP-GEGEILSRTIYLSLDPYMRGRLSASE--SYAASVELNSAIVGGTVSQVVKSNHPQFQVGDFILSNN-GWQTYAVSKAETLRKLDPTQ--APLSYSLGVLGMPGLTAYAALLDIGQPKEG--ETVVVSAASGAVGAVAGQIAKIKGA-RVVGIVGSDDKRDYIVKELGFDVGINRKTQELDSALKEAAPNGIDVYYDNTAGVILETVLQQINLGARIPLVGLISEYNATSTPSGPNLMPLLV----KRALIKGFLVTDYQHRFNDFLRDVSGWLQSGQLKYKEDVVMGLENAPHAFIGLLRGDNFGKLIVKVNDD... 336
52  3.000e-61 37  Polaromonas sp. JS666 gi|54030219||ref|ZP_00362357.1| COG2130: Putative NADP-dependent oxidoreductases protmod 3 .LNQQILLDNRPI--GEAVASNFKLVSSET-PALKDGQVLVRHHFLSLDPYMRGRMNDT--RNYAAAQPLGQVMIGGTAGEVMESRSPKFQPGDKVVGM-GGWQQYSVVDAEQLRKVDTTQVP--LSHYLGAVGMPGVTAYYGLVKIIEPKAG--QTVAVSAATGAVGSAFAALAKARGC-RTVGIAGGPDKCQYAVNELGFDACIDYKAASLSAALKEACPNGIDGYFENVGGMVLNAVLPLMNDFGRIAVCGMIAGYDGE-----PTPITHPALILRSRLKVQGFIVSEHMEVWPEALKELGTLVATGKLRPRETIAQGLQAAPEAFLGLLKGRNFGKQLVKL...... 337
53  3.000e-61 37  Pseudomonas fluorescens PfO-1 gi|48730597||ref|ZP_00264344.1| COG2130: Putative NADP-dependent oxidoreductases protmod 6 ..NRQFLLAKRPA--GAATRETFTYQELPVGEP-AAGQILVKNEYLSLDPAMRGWMNE--GKSYIPPVGLGEVMRALGVGKVVASNNPGFAVGDYVNGAI-GVQDYFLGEPKGFYKVDPKLAPLPV--YLSALGMTGMTAYFALLDVGAPKAGD--TVVLSGAAGAVGSIAGQIAKIKGC-RVIGIAGGADKCKFLVDELGFDGAIDYKSEDVLAGLKRECPKGVDVYFDNVGGDILDAVLSRLNFKARVVICGAISQYNNKEAVKGP---ANYLSLLVNRARMEGFVVMDYAAQYASAAQEMAGWMAKGQLKSKEDIVEGLETFPETLGKLFSGENFGKLVLKV...... 334
54  5.000e-61 40  Anabaena variabilis ATCC 29413 gi|46135146||ref|ZP_00162443.2| COG2130: Putative NADP-dependent oxidoreductases protmod 5 .VNQQIVLKSRP--VGEPQESDFALVESPI-PQLGEGEVLNRTIYLSLDPYMRGRLS--TNASYAASTELNSVIVGETVSQVIQSHHPDFQPGDFVLSNH-GWQTYAVAKGKTLRKLDPNQ--APLSYYLGVLGMPGLTAYAALLDIGQPKAG--ETVVISAASGAVGAVAGQIAKIKGA-RVVGIVGSDQKRDYIVKELGFNVGINRRTQEIASALKEAAPDGIDVYFDNTAGEILEAVLQQINLGARIPLVGLISQYNASSPPPGPNLLPLLI----KRALIKGFLVSDYQHRFSDFARDVTEWLQSGQLKYKEDIVVGLENAPRAFIGLLRGENFGKLIVEVS..... 334
55  7.000e-61 33  Anabaena variabilis ATCC 29413 gi|58428745||gb|AAW77782.1| quinone oxidoreductase [Xanthomonas oryzae pv. oryza protmod 17 ..NRRIVLASRP--QGEPSADNFRIEDIAVPPT-GHDQILVRNRFLSLDPYMRGRMDD--GPSYVAPVAIDALMEGGTVGEVIESNHADYHPGDLLV-LPGGWQTHSLLTPKTPLRKLPQDDGLPPSTALGVYGMPGFTAYAGLHEIG--KPQSGETLVVAAASGPVGATVAQLARLQGL-RVVAIAGGEEKVRYLRDTLRVDVALDHRADDFAEQLRAATPDGIDIYFENVGGKVFDAVLPQLNDFARIPVCGVIATYNSRGQVGPDRLPEFIGQLLRKRLTVRGFIQHDVIRLMPAFLREMGQWLREDKIQYREHVLHGLDSAPQGLVDVLRGKNFGKAVVALD..... 353
56  9.000e-61 38  Burkholderia cepacia R1808 gi|46323433||ref|ZP_00223797.1| COG2130: Putative NADP-dependent oxidoreductases protmod 18 .VNRQLLLKTRPEA--RVGREHFSLVETPVA-ALADGEVLVRVLYLSMDPTNRVWMSD--VPQYLPPVAIGEVMRALGIGRVVASRHADFAEGDLVQGLV-GWQDYARVPADQLVKLPAQ-SGLPLPTLLGACGMSGLTAYYGLTEIAPVQPG--ETLVVSAAAGSVGSIAGQIGKIHGA-RVVGIAGGADKCRYLTDTLGFDAAVDYKADDFREQLKAATPDGVHVNFENVGGDVMRAVLSRMVIGGRVALCGVISTYNS------GRAADDVGVLISKRLTMRGFLILDYRKSCE-AVQTLAGWLRDGRLKAEETVADGLENAPDVLNRLFDGDHRGKLVLRVDPQA.. 351
57  1.000e-60 41  Nostoc sp. gi|25535109||pir||AI1954 hypothetical protein all1188 [imported] - Nostoc sp. (s protmod 26 .VNQQIVLKSRP--FGEPQESDFALVESPI-PQPGEGEVLSRTIYLSLDPYMRGRLSANA--SYAASTELNSVIVGGTVSQVIKSHHLEFQAGDFVLSNH-GWQTYAVAKGETLRKLDPNQ--APLSYNLGVLGMPGLTAYAALLDIGQPKAG--ETVVISAASGAVGAVAGQIAKIKGA-RVVGIVGSDEKRDYIVNELGFDVGINRRTQEVSSALKEAAPDGIDVYFDNTAGEILEAVLQQINLGARIPLVGLISQYNASSPPPGPNLLPLLI----KRALIKGFLVSDYQYRFPDFVRDVAGWLQSGQLKYKEDVVVGLENAPRAFIGLLRGDNFGKLIVKVS..... 355
58  1.000e-60 34  Xanthomonas campestris pv. campestris str. ATCC 33913 gi|21229748||ref|NP_635665.1| quinone oxidoreductase [Xanthomonas campestris pv. protmod 6 ..NRRIVLASRP--HGEPGTDNFRIEDAPVPPT-GHNQILVRNRFLSLDPYMRGRMDE--GPSYAAPVAIDAVMEGGTVGEVLESNHPDYHPGELLV-LGGGWQTHTVLEPTAPLRKLPKDDALPLSTALGVYGMPGFTAYAGLHEIGKPQAG--ETLVVAAASGPVGATVAQLARLQGL-RVVAIAGGEEKVRYLRDTLRVDVALDHRAEDFAAQLRAATPDGIDVYFENVGGKVFDAVMPQLNDFARIPVCGVVATYNGQVAPGPDRLPDFIGQVLRKRLTVRGFIQHDFIRLMPAFLREMGQWLREDKIQYREHVLHGLDSAPQGLISLLRGENFGKAVVALD..... 342
59  2.000e-60 30  Arabidopsis thaliana gi|28827314||gb|AAO50501.1| putative allyl alcohol dehydrogenase [Arabidopsis th protmod 11 ..NKQIIFPD--YVTGFPKESDLKITTTTIDLRLPEGSVLVKNLYLSCDPYMRICMGKPDPLSLVPPYKTGVPIIGLGVSKVIDSGHPDYKKGDLLWGLV-GWEEYSVITLTTYSHFKIEHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKG--ETVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKEKVYLLKTKFGFDDAFNYKEEDFSAALKRYFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLVDPEGVHNLPTI----LYKRIQLQGFGVCDFYDKYPKFLDFVLPYIREGKITYVEDIAEGFESGPSALLGLFEGKNVGKQLFVVARE... 351
60  2.000e-60 38  Rubrivivax gelatinosus PM1 gi|47575609||ref|ZP_00245644.1| COG2130: Putative NADP-dependent oxidoreductases protmod 5 .INQQILLASRP--DGEPTVDNFRLVETPLAE-LEDGQVRVRHHYLSLDPYMRGRMNE--GRSYAQPQPLGEVMIGGTVGEVVASRHASFAVGDAVVGM-GGWQLYQTVDARQLQKVDTTQIP--LSAYLGAVGMPGVTAWYGLTQIIAPQAG--ETVVVSAASGAVGGAVGQLAKARGA-RVVGLAGGPEKCAYVSGELGFDACIDYRQKSLSAALKAACPNGIDGHFENVGGLILDAVMLRANAFSRIAFCGMIAGYNGE-----PIPMQNPSLILVNRMKLQGFIVTEHTALWPQALKELGAAVASGRLKYRESIAEGLAGAPQAFLGLLKGRNFGKQLVKL...... 339
61  2.000e-60 37  Rhodospirillum rubrum gi|48763487||ref|ZP_00268042.1| COG2130: Putative NADP-dependent oxidoreductases protmod 8 ..NRRIVLARRP--QGAPVAEDFRLET-APRPIAGDGQMLLRSLWLSLDPYMRGRMDD--GPSYAAPVALGAVMVGGTVCRVEDSRLDGFLPGDLVLA-YSGWQDYALSDGTGVERLEPHL--DRPSLALGALGMPGLTAYVGLLDIGKPQPG--ETVVVAAATGAVGATVVQIAKLKGA-RVVAIAGGAEKTAYARETLGADVAIDHHDPAFAQTLATACPKGIDVYFENVGGKVFDAVLPLLNTGARVPLCGLIATYNGAGPDNAKRLPELMRSLLVRRITLRGFIIGDHRDRIPAFQKDMAGWLASGQIIAREDVVDGLERAPAAFISLLKGGNFGKLVVAVG..... 340
62  2.000e-60 34  Cryptococcus neoformans var. neoformans B-3501A gi|50260570||gb|EAL23225.1| hypothetical protein CNBA5690 [Cryptococcus neoforma protmod 7 ..NVQIILNERPQK-GPVTDTTFKSKTVDVPE-LKDGEILARVDYASVDPTMRGWINE--GRSYMPPVEIGAAMRANGLGTVIASKAKDFKAGDKVLGLLN-WQEYYVGPTEGLTKRETPEGARDVDH-LGLFGMTGLTAYFGMIEVGKIKDGDHV--VISGAAGAVGLVATQIALAHPNCKVTVIAGSKEKL-DYLKKLGAHNALNYKDDDFKEQFKKV--GLIDVYFDNVGGKILDMALAQLNPFARIVACGAISQYNATVPDPIYNYFNIISMK----ATMRGFIVFQFADRFPEGIKYLSDLVKKGKMEFNYHIIDGLDSCVQALREMFEGKNLGKTVVRVSNEAA. 339
63  2.000e-60 33  Cryptococcus neoformans var. neoformans JEC21 gi|57223340||gb|AAW41384.1| cytoplasm protein, putative [Cryptococcus neoformans protmod 7 ..NVQIILNERPQK-GPVTDTTFKSKTVDVPE-LKDGEILARVDYASVDPTMRGWINE--GRSYMPPVEIGAAMRANGLGTVIASKAKDFKAGDKVLGLLN-WQEYYVGPTEGLTKRETPEGARDVDH-LGLFGMTGLTAYFGMIEVGKVKDGDHV--VISGAAGAVGLVATQIALAHPNCKVTVIAGSKEKL-DYLKKLGAHNALNYKDDDFKEQFKKV--GLIDVYFDNVGGKILDMALAQLNPFARIVACGAISQYNATVPDPIYNYFNIISMK----ATMRGFIVFQFADRFPEGIKYLSDLVKKGKMEFNYHIIDGLDSCVQALREMFEGKNLGKTVVRVSNEAA. 339
64  3.000e-60 30  Arabidopsis thaliana gi|21593645||gb|AAM65612.1| allyl alcohol dehydrogenase, putative [Arabidopsis t protmod 11 ..NKQIIFPD--YVTGFPKESDLKITTTTIDLRLPEGSVLVKNLYLSCDPYMRICMGKPDPLSLVPPYKTGVPIIGLGVSKVIDSGHPDYKKGDLLWGLV-GWEEYSVITLTTYSHFKIEHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKG--ETVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKEKVDLLKTKFGFDDAFNYKEEDFSAALKRYFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLVDPEGVHNLPTI----LYKRIQLQGFGVCDFYDKYPKFLDFVLPYIREGKITYVEDIAEGFESGPSALLGLFEGKNVGKQLFVVARE... 351
65  3.000e-60 31  Arabidopsis thaliana gi|17529140||gb|AAL38796.1| putative quinone oxidoreductase [Arabidopsis thalian protmod 5 ..NKQVVLKN--YVSGFPKESDFDFKTVEFKLPGGSNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAYAPGKPIFGYGVSRVIESGHPDYKKGDLLWGIV-GWEEYSVITPMTHMHFKIQHTDIPLSYYTGLLGMPGMTAYAGFYEVCSPKEG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSTEKVNLLKTKFGFDDAFNYKEEDLSAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFAVFDFYEKYSKFLDFVLPHIKEGKITYVEDVADGLEKGPEALVGLFHGKNVGKQVVVIARE... 345
66  3.000e-60 34  Idiomarina loihiensis L2TR gi|56459426||ref|YP_154707.1| Predicted NADP-dependent oxidoreductases [Idiomari protmod 5 ...KAIKLVKRPEP--GPVSANIFEVTEKELPKAGSGEILIKQRQMSLDPAMFGWMSPDTE-SYIPPVELNTVMRSSGVGEVVESNHPEFEVGDRVMGMM-GWQEYALSDGKGINKVQADVPDE---TVLSVFALPGLTATQGLLNVGKPKNG--ETIVVTGAAGSVGSIVGQIAKAEGL-KVIGVVGSDEKANWIVNELGFDGAINYKTDDLRDQLTKLTPDGVDLYFENTGGPIQNLVVERMNAHGRVVVCGMIADYDKEVPSPGP----SWVPVIKKRLTIQGFTMPDHFDQIPSLLQQLTPYVMSGKIKHRSHILEGLESAIEGLNMFFTGDNKGKLIVKL...... 332
67  4.000e-60 31  Arabidopsis thaliana gi|23297366||gb|AAN12951.1| putative quinone oxidoreductase [Arabidopsis thalian protmod 5 ..NKQVVLKN--YVSGFPKESDFDFKTVEFKLPGGSNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAYAPGKPIFGYGVSRVIESGHPDYKKGDLLWGIV-GWEEYSVITPMTHMHFKIQHTDIPLSYYTGLLGMPGMTAYAGFYEVCSPKEG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSTEKVDLLKTKFGFDDAFNYKEEDLSAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFAVFDFYEKYSKFLDFVLPHIKEGKITYVEDVADGLEKGPEALVGLFHGKNVGKQVVVIARE... 345
68  6.000e-60 37  Rhodopseudomonas palustris CGA009 gi|39933552||ref|NP_945828.1| putative oxidoreductase [Rhodopseudomonas palustri protmod 5 .VNRQILLIEKPKEKLGP--EHFRLAESPIPEP-KDGEALVKVRYISLDAANRAWMQ---GATYRAAVETDSVMPGGSVAEVVSSKAPGLVSGDLVFA-DTGWQDYAVLPAKHLAKLPKV---EPMTHLLSVYGIAGLTAYFGLLDIGKPRAG--ETVVVSAAAGSVGSIVGQIAKIKGC-RVVGIAGGKQKCDWLVNELGFDAAVDYKDGALFKALRAAAPNGIDVYFDNVGGDILEACLPQMNLKGRIACCGAVSQYDRTPSATGP--RGIPGLIVVKRLIMQGFIVMDYMDQRDEAVAKLQEWVTSGKLKVQEDVIDGLENTPQALIGLLAGENRGKRMVKV...... 333
69  6.000e-60 32  Ustilago maydis 521 gi|46099247||gb|EAK84480.1| hypothetical protein UM03548.1 [Ustilago maydis 521] protmod 11 ....QIVLRERPTAAIGENDSTYEKRTVPVPQELKDGEVLVRVEYVSLDPAMRGWLRD--ARSYLPPVQIGEVMRAGGVGVIVASKFPGLSKGDQISGTL-GWQQYARVPGKSVEKRSIREGS-SLLDYLGPLGSSGQTAYWGIFDVAAIKKDD--VVVVTGAAGSVGSVAVQLAKLKGC-KVIAVAGADDKCQWLKDSLGADEALNYKDPNFKKTYREIKYGYIDAIFENVGGDILDMSLLCMKPHARIALCGAISDYNNPKPNGLKNYQTIIAM----RIKLQGFIVFDYAKRYSEAEDDMAKWMKEGKLARKFHVVKSLEQCPKALNDLFAGKNVGKMVVKVAP.... 363
70  6.000e-60 38  Bradyrhizobium japonicum USDA 110 gi|27375215||ref|NP_766744.1| probable oxidoreductase [Bradyrhizobium japonicum protmod 5 .INRQILLVEKPS--GKLGPEHFKMVDGAMPEP-KDGEALLRVRYISLDAANRAW---MHGATYRSAVEANSVMAGGGIAEVVSSKAPGLAAGDIVFG-DTGWQEFAAVPAKHLTKMPK---LEPMTHLLSVFGIAGLTAYFGLLEVGKPKEG--ETVVVSAAAGSVGSIVGQIAKIKGC-RVIGIAGGADKCNWLTSELGFDAAVDYKDGAVFKALRAAAPTGIDVYFDNVGGDILEACLPQMNNYGRIACCGAISQYDGAPAAHGP--RGVPGLIVVKRLVMQGFIVMDYMKDSQRALAELQGWVKSGKLKVQEDIIDGLENTPKALIGLLAGENRGKRMVKL...... 333
71  7.000e-60 40  Exiguobacterium sp. 255-15 gi|45531674||ref|ZP_00182708.1| COG2130: Putative NADP-dependent oxidoreductases protmod 4 ...QQIVLASRP--EGRPTRDTFRYETIEL-DALKADQVLVETLYISVDPYMRGRMND--ARSYSQPFDLDAPIQGGVVARVVESTSDLLTVGDTVVGMLD-WATKSVVDAKQVRKIDATL--APVSTALGVLGMTGMTAYFGLLDIGNPQSG--ETVVVSAAAGAVGSIVGQIAKIKGA-RVVGIAGSAEKIQYLKEELGFDEVINYKTEQIGEALDRTCPDGIDVYFENVGGAIGDAVLDRLNPFARIPVCGAISGYNEQADLGPRVQSKLIIA----RARMQGFLVGDYGKRFKEAAEQLGKWVSNGELKYEETIFEGFEQVPDAFLGLFDGSNTGKLLVKL...... 330
72  7.000e-60 34  Silicibacter pomeroyi DSS-3 gi|56679583||gb|AAV96249.1| NADP-dependent oxidoreductase, L4bD family [Siliciba protmod 7 ....RIALASRP--TGAPEAANFSLEE-APVPTPGPGEVLVRVHYMSLDPYMRGRMDD--AKSYAAPVPIGGTMEAGGVGEVIASNDPGFAPGDFAFGMF-GWATHGVQPGKMLRKIDPKVMP--ITTALGVLGMPGFTGWFGLMEHGRPKAG--ETLVVAAATGPVGSMVGQVARLAGL-RTVGVAGGADKCRIATETFGFDACLDHRAYDLRRALAAECPDGIDIYFENVGGKVLEAVLPLMNNFGRIPVCGMISWYNAGASDPGLTGPAIWRSILVKFLSVNGFIISNHFDRYPAFLAEIAPKLASGEIRYLEDVAEGLENAPAAFMAMLRGGNTGKQIVKL...... 345
73  1.000e-59 31  Arabidopsis thaliana gi|886428||emb|CAA89838.1| zeta-crystallin homologue [Arabidopsis thaliana] gi|9 protmod 5 ..NKQVILKD--YVSGFPTESDFDFTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIV-AWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEG--ETVYVSAASGAVGQLVGQLAKMMGCY-VVGSAGSKEKVDLLKTKFGFDDAFNYKEEDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE... 345
74  1.000e-59 32  Arabidopsis thaliana gi|20259087||gb|AAM14259.1| putative quinone oxidoreductase [Arabidopsis thalian protmod 4 ..NKQVIFKDHVS--GFPKESDFNFTTVELRVPEGSKSVLVKNLYLSCDPYMRSRMGKPDPSSALAAYAPGKPIYGYGVSRVIESGHPDYKKGDLLWGIV-GWEEYSVITPMAHMHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSKEKVDLLKTKFGFDDAFNYKEEDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFVVADFYDKYPKFLELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVIARE... 343
75  2.000e-59 31  Arabidopsis thaliana gi|21539447||gb|AAM53276.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 5 ..NKQVILKD--YVSGFPTESDFDFTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIV-AWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEG--ETVYVSAASGAVGQLVGQLAKMMGCY-VVGSAGSKEKVDLLKTKFGFDDAFNYKEEDLTAALKRCFTNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE... 345
76  3.000e-59 37  Thermobifida fusca gi|48837184||ref|ZP_00294179.1| COG2130: Putative NADP-dependent oxidoreductases protmod 5 ..AREFHLIARP--QGEPAVTDFALVTRTLPDP-GPGELLVRNLVLSVDPYMRGKMSG--VRTYTDPYELNAPMEGGAVGVVEASTDPAVPTGTLVVH-NAGWRSHALLPASRVRPLPAD-SPVDPSVYLGALGMPGLTAYVGLRHKAGIREGD--TVFVSGAAGAVGSMVGQLAALYGARRVIGSAGSPEKVAYLRDELGFDAAFDYRAAPVREQLADAAPDGIDVYFDNVGGDHLEAAIACANDFARFAICGAISGYNAT---SAPRAPRNLFQIVTKRLTLRGFIVSDEPHLAEEFQREVAPAVADGRIKVRETVVEGLERTPEAFISMLRGGNIGKMVVRVAE.... 337
77  3.000e-59 37  Ralstonia metallidurans CH34 gi|48772643||ref|ZP_00276985.1| COG2130: Putative NADP-dependent oxidoreductases protmod 7 ...KRIVLASRPEA--AVTPDNFRIEELPVPE-LADGQVLVRNHFLSLDPYMRGRMSDS--KSYADPQPLNEVMIGGTVGEVIASKNPKWNVGDKVIGMF-GWQELGVSDGGMMQKVDTTHIP--LSAYLGSVGMPGVTAWYGLNKIIAPKAG--ETVVVSAASGAVGSVVGQLAKLAGCY-VVGVAGGKEKCDYVVNELGFDACVDYKAKELYAMVKAVTPNGIDGYFENVGGDILDVVLSRLNPFARIAVCGLIAGYDGQ-----DMPIRNPRAILVARAKIEGFIVSEHMELWPQALRELGTYVAQGKIKFRESIAEGLASAPEAFIGLLKGKNFGKQLVKLA..... 337
78  5.000e-59 37  Polaromonas sp. JS666 gi|54031924||ref|ZP_00364057.1| COG2130: Putative NADP-dependent oxidoreductases protmod 8 .VNHQVRLASRPA--GLPTRANWNFTTEPVAEP-GPGGVLVKTLYLSLDPAMRGWMND--AKSYIPPVELGAVMRAGGVGKVIASQNPAFAVGDYVNAGLD-VQEYCLIPADQIFKIDPRLG---LTSWLNVLGLPGMTGYFGLLEVGLPKAG--ETVVVSGAAGAVGQTVGQIARLKGC-RVVGIAGGKAKCDWVVNELGFDACIDYKNSDVRAGLKEHCPKGVDIYFDNVGGEILDLVLAKLARGARIIICGAISQYNNTTPVKGP---ANYLSLLVNRARMEGIVVFDYADRYHLAVAELAGYLKAGTMKSKEDVVVGLDTFPETLLKLFNGENFGKLVLQVAKE... 344
79  6.000e-59 39  Burkholderia mallei ATCC 23344 gi|53723624||ref|YP_103085.1| oxidoreductase, zinc-binding dehydrogenase family protmod 4 .VNRRVLLVSRPEREAR--VENFELVETPLAP-LAEGEVRVRNHFLSIDPYMRGRMN--AGRSYAEPQPLGEVMGGGTAGEVVESRNPAFAPGDRVIGAY-GWQEYGTSAGKELRKVDTTRVP--LSAYLGAAGMPGVTAWYGLNRIIRPRAG--ETLVVSAASGAVGSVVGQLAKLAGC-RAVGIAGGADKCRYVVDTLGFDACVDYKAGRLADDLAAAAPDGVDGCFENVGGAVLDATLARMNPFGRIAMCGMIAAYD-----GAPAPLANPALILRERLLVQGFIVSEHFDVWPEALAQLASLVANRQLHYRETIAQGLERAPDALLGLLKGRNFGKQLVAL...... 331
80  6.000e-59 32  Arabidopsis thaliana gi|21554121||gb|AAM63201.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 4 ..NKQVIFKDHVXXFPKESDFNFTTTTVELRVPEGSKSVLVKNLYLSCDPYMRSRMGKPDPSSALAAYAPGKPIYGYGVSRVIESGHPDYKKGDLLWGIV-GWEEYSVITPMAHMHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSKEKVDLLKTKFGFDDAFNYKEEDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFVVSDFYDKYPKFLELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVIARE... 343
81  7.000e-59 32  Arabidopsis thaliana gi|886430||emb|CAA89262.1| zeta-crystallin homologue [Arabidopsis thaliana] gi|1 protmod 4 ..NKQVIFKDHVS---FPKESDFNFTTVELRVPEGSKSVLVKNLYLSCDPYMRSRMGKPDPSSALAAYAPGKPIYGYGVSRVIESGHPDYKKGDLLWGIV-GWEEYSVITPMAHMHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSKEKVDLLKTKFGFDDAFNYKEEDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFVVADFYDKYPKFLELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVIARE... 342
82  2.000e-58 40  Halobacterium salinarum NRC-1 gi|15789969||ref|NP_279793.1| YfmJ [Halobacterium salinarum NRC-1] gi|10580385|g protmod 50 ...REWVFAERP--EGEPDMDSFELRERDVPEP-RHGELLVRVRYLSVDPYMRGRMRDSD--SYADPWTVGEPLSGGVVGEVVESESDAYEAGDLVSG-NGTWADYSLLDAANVAPVDPSVADLPA--YLGVLGMPGRTAYFGLLEVGAPKPGD--TVVVSGAAGAVGSVVGQIAKHNGC-RVVGFAGSEEKVDWLTEDLGFDAGINYKQDDYSAALDDAAPDGVDVYFDNVGGPISDAVFTKLNVDARVAVCGQIAHYNNEVPTGPRKLPQLIAP----RAKVQGLLVGDFATRFGEASEQLGQWVAAGDIEHRETVVSGLENAPDAFLGLFSGDNIGKQVVGVSE.... 380
83  2.000e-58 35  Staphylococcus aureus subsp. aureus Mu50 gi|14247960||dbj|BAB58349.1| similar to quinone oxidoreductase [Staphylococcus a protmod 3 ..NKQILFNKIP--EGMPQEDTFKIEEIDTPKLESDG-VLVQTLYISVDPYMRGRM--TKADSYVQPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGML-PWRIINHVQADQITKVPT--TDVPLDLYLSVLGMPGQTAYHGLLDIGQPKAGD--TVVVSAASGAVGSVVGQIAKIKGC-RVVGIAGGDKKVNYLTETLGFDAGIDYKKEDFAEALAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVPVCGAISSYNHPEADIGPR---IQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQSQVTIEDGFENAPHAFKNLFTGDNFGKQVIKVTE.... 333
84  2.000e-58 36  Rubrivivax gelatinosus PM1 gi|47574877||ref|ZP_00244912.1| COG2130: Putative NADP-dependent oxidoreductases protmod 8 ..NRRFVLAERPA--GMPTASTFRLETVDI-PKPAEGQMLLRTLWLSLDPYMRIRLNE--GYSYRPGVDLGGAMVGGTISRVEESRHPGYKAGDLVIAA-SGWQDYALSDGSDIIKLDPSM--AHPSWGLGVLGMPGFTAWHGLVNIGEPKAG--ETFVIAAATGAVGQIAGQLAKARGL-RAVGIAGGADKCRYAVQELGFDACVDHRSADLPGDLKKACPDGIDIYFENVGGAVFDAVLPLFNLHSRMAICGLIAHYNGGGESGDRMPLLLTSLLKRLK-TQGFIIYDHYAEHYEAFFREMSGLLAQGRIKVREDVIDTLEGAPQGLVSLLEGRNFGKVVVKVA..... 340
85  3.000e-58 36  Propionibacterium acnes KPA171202 gi|50841893||ref|YP_055120.1| zinc-binding dehydrogenase [Propionibacterium acne protmod 10 ...RAVHLASRP--HGAPTEDNFRIEEISLPE-LSDGQILVANDVMSVDPYMRGRMND--VKSYVPPFHIDRPLDGGAVGTVIESRSEDIPEGSHVSH-QLGWREHAVLNAGDAHIIDTDI--APASAYLSVLGMTGLTAYAGLTRAAEMKAGDAV--FVSGAAGAVGSMVGQLARLLGASRVIGSAGT-DAKVARLRELGFDAAFNYHDGPSTELLGQAAPDGIDVYYDNVGGDHLEAAIDHLNIDGRVAMCGAISQYN---SVEPPCAPRNLALAIGKRLTLRGFVIAKYAEERPEFQQRMAEWLPADEIHWDETFRDGLDAAPQAFIDMLDGANTGKMLVRL...... 338
86  3.000e-58 39  Burkholderia pseudomallei K96243 gi|53719066||ref|YP_108052.1| putative oxidoreductase [Burkholderia pseudomallei protmod 4 .VNRRVLLVSRPEREAR--VENFELVETPLAP-LAVGEVRVRNHFLSIDPYMRGRMN--AGRSYAEPQPLGEVMGGGTAGEVVESRNPAFAPGDRVIGAY-GWQEYGTSTGKELRKVDTTRVP--LSAYLGAAGMPGVTAWYGLNRIIRPRAG--ETLVVSAASGAVGSVVGQLAKLAGC-RAVGIAGGADKCRYVVDTLGFDACVDYKAGRLADDLAAAAPDGVDGCFENVGGAVLDATLARMNPFGRIAMCGMIAAYD-----GAPAPLANPALILRERLLVQGFIVSEHFDVWPEALAQLASLVANRQLHYRETIAQGLERAPDALLGLLKGRNFGKQLVAL...... 331
87  3.000e-58 37  Burkholderia pseudomallei K96243 gi|53722280||ref|YP_111265.1| putative oxidoreductase/dehydrogenase [Burkholderi protmod 8 ..NRRIVLHSRP--KGAPTPENFRTETAAV-PVPAPGEVLLRTIWLSLDPYMRGRMSD--APSYAAPVELGGVMVGGTVSRVVSSSVPAFRDGDLVLS-NAGWQDYAVSDGTDLMPLADVAHP---SYALGVLGMPGFTAYFGLLHIGEPKAG--ETVAVAAASGAVGAVVGQIAKLKGC-RVVGIAGGADKCRYVAGTLGFDACVDHHDPDFAKQLAAACPDGIDVYFENVGGAVFDAVLPLLNDHARVPVCGLIAHYNDELPGGPNRLPLLTSSVLRKRIRMQGFIILDYADVYPAFLKDMSEWVAQGKVKPREDVVDGLDAAPRALIGLLGGKNFGKVVVRVGPD... 343
88  3.000e-58 37  Novosphingobium aromaticivorans DSM 12444 gi|48848089||ref|ZP_00302336.1| COG2130: Putative NADP-dependent oxidoreductases protmod 3 .VNRRFLLARRP--HGTPVPEDFSLVEQTVPDAPEGGFV-VRNCYASLDPAQRGWMDD--APSYMPPIPLGTPVRASTVGVVATSRNPDFAVGDWVLGLNGLEDYSVNEPGGFTMKVDPSVVQSP-SRFLSAMGAVGLTAYFGLTEVAKPKPG--ETLLVSGAAGAVGSAVGQIGKILGC-RVIGIAGGPAKCRRLIDDYGFDVAIDYKGKSVAAEIREAAPGGADVVFENVGGDVMDAELLNLAKHARIVLCGLISEYNSPTKIGVRNLWQVLTQ----QATLFGYLIMDYAPRFAEGGAVMAQWMAEGRLRIDEDVQVGLENAYDAFMRLFTGANTGKLVLKIAD.... 338
89  4.000e-58 33  Rhodobacter sphaeroides 2.4.1 gi|46193237||ref|ZP_00207622.1| COG2130: Putative NADP-dependent oxidoreductases protmod 7 .INRRVVLAQRP--KGTPDESTLRMEEVPISEP-AEGQMLLRTVWLSLDPYMRGRMNDT--KSYAKPVEIGGVMTGQVVAEVMQSSLPGFEAGDMVLA-GSGWQDYALSDGTEVVNL--GKAPERPSRALGILGMPGYTAYAGLLKIGEPQPG--ETVVVAAASGPVGATVGQIAKLKGC-RAVGVAGGADKCRYVVETLGFDACIDHRAPDFEAQLAAACPNGIDIYFENVGGRVLYGVLPLLNPFARMPVCGIVSWYNSPLPEGPDMAPALMGTILRMKVKLQGFIIFDPRSLYAEFAREMTGWLAEGKVKYREQVVEGLEAAPQALNDLLAGRNFGKMVVKL...... 342
90  6.000e-58 34  Staphylococcus aureus subsp. aureus MRSA252 gi|49484407||ref|YP_041631.1| putative zinc-binding dehydrogenase [Staphylococcu protmod 4 ..NKQILFNKIP--EGMPQEDTFKIEDIDTPKLESDG-VLVQTLYISVDPYMRGRM--TKADSYVQPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGML-PWRIINHVQADQITKVPT--TDVPLDLYLSVLGMPGQTAYHGLLDIGQPKDGD--TVVVSAASGAVGSVVGQIAKIKGC-RVVGIAGGDKKVNYLTETLGFDAGIDYKKEDFAESLAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVPVCGAISSYNHPEADIGPR---IQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQSQVTIEDGFENAPRAFKNLFTGDNFGKQVIKVTE.... 334
91  6.000e-58 35  Xenopus laevis gi|50418008||gb|AAH77917.1| MGC80838 protein [Xenopus laevis] protmod 3 .VAKSWTMVRH--FEGAPKPEDFKLIEKEL-PPLKDGEVLLESEFWSVDPYMRPYSKQK--------LKEGDVMMGSQVARVMESKNPAFPVGGYYVA-YAGWTTHFISDGKGLAPLPSNWPNLPKSLALGAAGMPGLTAYFGLLDLCNPKEGD--VVLVNAAAGAVGSIVGQIAKIKGC-KAVGSAGSDDKLGF-LKEIGFDEVFNYKTSSLAEALKKASPDGYDCYFENVGGKFADAALQQMKDFGRIAVCGAISLYNDSVPSTGPY---IQPYILFKQLRMEGFIVTRWQDRFPEGQKQLLQWIIEGKLKYHEHITNGFENMPASFMGMLKGENIGKAIIKV...... 329
92  1.000e-57 34  Ralstonia eutropha JMP134 gi|45514894||ref|ZP_00166450.1| COG2130: Putative NADP-dependent oxidoreductases protmod 4 .MNRRWILRQRP--VGDIGDNDLQLVE-APLPRPGDGEILVRNIYLMVAPTNRVWMSEID--QYMAPVALGEVMRGVTMGVVTESHHPDFKAGDIVEGGM-AWEEYSVTKMARRVPV---EYGLPLHAYASVLGNSGMTAYFGMLDIARPKAG--ETIVVSAAAGGVGSIAGQIGKILGC-RVVGVAGGQNKCRLVREEFGLDACVDYKAGNVLADLRAACPDGIDVDFENVGGETMDAVLALINPGARIAMCGMISTYNASGDWWSPKMFRNVIM---KRARIEGFLIADYRSRFHEAVEVMAKWVRDGQLKYRVDIVEGIEQAPAALNRLFTGKNIGKQLVRLAPES.. 336
93  1.000e-57 35  Staphylococcus aureus subsp. aureus MW2 gi|21205284||dbj|BAB95978.1| MW2113 [Staphylococcus aureus subsp. aureus MW2] gi protmod 3 ..NKQILFNKIP--EGMPQEDTFKIEETDT-PKLESDGVLVQTLYISVDPYMRGRM--TKADSYVQPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGML-PWRIINHVQADQITKVPT--TDVPLDLYLSVLGMPGQTAYHGLLDIGQPKAGD--TVVVSAASGAVGSVVGQIAKIKGC-RVVGIAGGDKKVNYLTGTLGFDAGIDYKKEDFAEALAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVPVCGAISSYNHPEADIGPR---IQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQSQVTIEDGFENAPHAFKNLFTGDNFGKQVIKVTE.... 333
94  1.000e-57 35  Burkholderia cepacia R18194 gi|46314853||ref|ZP_00215437.1| COG2130: Putative NADP-dependent oxidoreductases protmod 8 ..NRQIILNSRP--VGAPTPGNFRTESGEV-PTPGAGQVLLRTVWLSLDPYMRGRMSD--APSYAAPAELGQPMVGGTVSQVVSSNLPAFREGDLVVA-GAGWQDYALSDGRDL--IPLGRNFAHPSYALGVLGMPGFTAYTGLLKIGEPKAG--ETVVVAAASGAVGAVVGQIAKLKGC-RVVGVAGGADKCAYVTDTLGFDACVDHRDPAFAAKLKEACPNGIDIYFENVGGAVFDAVWPLLNDHARVPVCGIIAHYNDAVSTGRDRVPALVGTILRKRIRMQGFIILDYATGYATFMKDMSEWVAQGKVKTLEDVVPDLADAPEALIGLLAGKNFGKVVVRVGPDE.. 350
95  1.000e-57 28  Arabidopsis thaliana gi|23308195||gb|AAN18067.1| At5g37940/K18L3_100 [Arabidopsis thaliana] gi|975849 protmod 12 ..NNQVIL--RDYVSGFPKQSDLYITTIDLRVPPGSMAVLVKNLYLSCDPHSRTRMGKPDPASMAHAFTIGKPISGFGVAKAIDSGHPNYKTGDLLWGRV-GWEEYSVITPTPSSHFKIHHTDVPLSFYTGLLGIPGLTAYVGFYEICSPKKG--ETVFVSAASGAVGQLVGQFAKMAGCY-VVGSASSKEKVDLLKTKFGYDDAFNYKEEDLSAALKRCFPEGIDIYFENVGGKMLDAVLQNMRTHGRIAACGMISQYNLKEPEGLHN----TATIVHKRIRVQDFAAVEFFDRYSKFLDFILPHVREGKITYVEDIAQGLENGPSALIGLFHGKNVGKQLVEVARE... 353
96  1.000e-57 36  Burkholderia cepacia R1808 gi|46321867||ref|ZP_00222241.1| COG2130: Putative NADP-dependent oxidoreductases protmod 8 ..NRRIVLNARP--VGAPTANDFRVET-ADVPVPGAGQVLLRTIWLSLDPYMRGRMSD--APSYAPPVALGDVMVGGTVSRVVASNLPAYREGDLVVA-GSGWQDYALSDGRDL--IPLGRDFAHPSYALGVLGMPGFTAYTGLLSIGEPKAG--ETVVVAAASGAVGSVVGQIAKLKGC-RVVGVAGGAEKVAYVKDTLGFDACVDHRDPQFAARLKDACPDGIDVYFENVGGAVFDAVWPLLNDHARVPVCGIIAHYNDAVSAGRDRVPALMGTILRKRIRMQGFIILDYATGYAPFLKEMSEWVAQGKVKTLEDVVPDLTEAPQALIGLLAGKNFGKVVVRVGPD... 349
97  1.000e-57 35  Staphylococcus aureus subsp. aureus MSSA476 gi|49245419||emb|CAG43896.1| putative zinc-binding dehydrogenase [Staphylococcus protmod 4 ..NKQILFNKIP--EGMPQEDTFKIEETDTPKLESDG-VLVQTLYISVDPYMRGRM--TKADSYVQPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGML-PWRIINHVQADQITKVPT--TDVPLDLYLSVLGMPGQTAYHGLLDIGQPKAGD--TVVVSAASGAVGSVVGQIAKIKGC-RVVGIAGGDKKVNYLTGTLGFDAGIDYKKEDFAEALAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVPVCGAISSYNHPEADIGPR---IQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQSQVTIEDGFENAPHAFKNLFTGDNFGKQVIKVTE.... 334
98  2.000e-57 30  Arabidopsis thaliana gi|9755701||emb|CAC01713.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 5 ..NKQVVLKN--YVSGFPKESDFDFKTVEFKLPGGSNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAYAPGKPIFGYGVSRVIESGHPDYKKGDLLWGIV-GWEEYSVITPMTHMHFKIQHTDIPLSYYTGLLGMPGMTAYAGFYEVCSPKEG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSTEKVDLLKTKFGFDDAFNYKEEDLSAALKRFVRIGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFAVFDFYEKYSKFLDFVLPHIKEGKITYVEDVADGLEKGPEALVGLFHGKNVGKQVVVIARE... 358
99  2.000e-57 31  Oryza sativa (japonica cultivar-group) gi|38345384||emb|CAD41251.2| OSJNBa0067K08.13 [Oryza sativa (japonica cultivar-g protmod 5 ..NKKIVL--RNHVTGFPKESDMELVAATRVPEGTDGAVLVKNLYLSCDPYMRGRMSSHDG-SYVDAFVVGEAITGYGVGKVVDSSHPGFKAGDLVWGM-TGWEEYSLIKDPSRALFAIRHPDLPLSYYTGLLGMAGFTAYVGFHEICAPREG--ERVYVSAASGAVGQLVGQFAKLMGCY-VVGSAGSDDKVRLLREKFGFDDAFNYKKEDLSAALKRCFPEGIDIYFENVGGAMLDAVLLNMRVRGRVAACGMISQYNLEHPDPVHNLTAI----VTKRLRIEGFIVSDHYARYREYEEKAARYVKEGKIAYVEDVAEGLENAPAALIGLFSGRNVGKQVVVVARE... 345
100  2.000e-57 40  Haloarcula marismortui ATCC 43049 gi|55378302||ref|YP_136152.1| quinone oxidoreductase [Haloarcula marismortui ATC protmod 5 ..NRVYRLAKRP--EGTPDHDTFELSEEEIPEP-GPGEVLIKTLYLSVDPYMRDRMRDSE--SYEEPWDVGDALKGAVVGEVVESNGARFDEGDVVTGEL-EWAEYATAPGPVLTEVNPEL--APISTALGVLGMPGLTAYFGTREVAQPAAGD--TFVVTGAAGAVGSVAGQLAKLQGA-RVVGFAGSDEKVSFLEDDLGFDVGINYKTDDYRAALDEAAPDGVDAYFDNVGGPITDAVFTRLNTDARVAVCGQISLYNSE---EIPMGPRKLTQVIQSRATVEGLLVSDFEPRFEEATKQLGQWVASGDISYRETVTEGIENAPDAFLGLFEGENIGKQLVQVAE.... 336
101  3.000e-57 31  Arabidopsis thaliana gi|6714428||gb|AAF26116.1| putative NADP-dependent oxidoreductase [Arabidopsis t protmod 11 ..NKQVIL--RDYVTGFPKESDLIFTDSTIDLKIPEGSVLVKNLYLSCDPYMRIRMGKPDPGTAAPHYIPGEPIYGFSVSKVIDSGHPDYKKGDLLWGLV-GWGEYSLITPD-FSHYKIQHTDVPLSYYTGLLGMPGMTAYAGFYEICSPKKG--ETVFVSAASGAVGQLVGQFAKIMGCY-VVGSAGSNEKVDLLKNKFGFDDAFNYKEPDLNAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGVHNLANV----IYKRIRIKGFVVSDYFDKHLKFLDFVLPYIREGKITYVEDVVEGLENGPSALLGLFHGKNVGKQLIAVARE... 350
102  3.000e-57 37  Burkholderia mallei ATCC 23344 gi|53716450||ref|YP_105067.1| oxidoreductase, zinc-binding dehydrogenase family protmod 5 .VNRQLRLKARP--DGRVGHEHFTLAE-APLPPLGPGEMLVRVLYLSMDPTNRVWMSDIP--QYLPPVAIGDVMRALGIGRVVASNAPGFAEGDLVQGLV-GWQDYAHVRADEIAQYTPAALGLPLPRLLGACGMSGLTAYYGLTEIAPVQPG--ETLVVSAAAGSVGSVAGQIGKIHGA-RVVGIAGGADKCRYLTDELGFDAAVDYKSDDWKRALKDATPDGVHVSFENVGGEIMRAVLSRMAIGGRVALCGVIANYNNGRPADDV------SVLIAKRLTMRGFLILDYRKSRE-AIATLAGWLRDGRLKAEETVADGLTNAPDVLNRLFDGSHRGKLVLRVDPQA.. 338
103  3.000e-57 29  Arabidopsis thaliana gi|30725306||gb|AAP37675.1| At5g38000 [Arabidopsis thaliana] gi|8978254|dbj|BAA9 protmod 12 ..NNQVIF--RNYVNGFPKESDLYIATVDLRVPPGSMAVLVKNLYLSCDPHSRTRMGKPDPASMAHAFTIGKPISGFGVAKAIDSGHPNYKTGDLLWGRV-GWEEYSVITPTPSSHFKIHHTDVPLSFYTGLLGIPGLTAYIGFYEICSPKKG--ETVFVSAASGAVGQLVGQFAKMAGCY-VVGSASSEEKVDLLKTKFGYDDAFNYKEEDLSAALKRCFPEGIDIYFENVGGKMLEAVLENMRTHGRIAACGMISQYNLKKPEVLHN----TATIVHKRIRVQGFAAVEFFDRYSKFLDFILPHVREGKLTYVEDISQGLENGPSALIGLFHGKNVGKQLVEVAR.... 352
104  5.000e-57 28  Arabidopsis thaliana gi|21536967||gb|AAM61308.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 12 ..NNQVIL--RNYVSGFPKESDLYITTVDLRVPPGSMAVLVKNLYLSCDPFSRIRPDPSSPASLARAYSIGKPISGYGVAKAIDSGHPNYKTGDLLWGRV-GWEEYSVINPTPSSHFKIHHADVPLSFYTGLLGIPGLTAYVGFYEICSPKKG--ETVFVSAASGAVGQLVGQFAKMAGCY-VVGSASSKEKVDLLKTKFGYDDAFNYKEEDLSAALKRCFPEGIDIYFENVGGKMLEAVLENMRTHGRIAACGMISQYNLKEPEGVHNLASI----VYKRIRVQGFAAVEFFDKYSKFLDFILPYVREGKITYVEDIAQGLENGPSALIGLFHGKNVGKQLVAVARE... 353
105  5.000e-57 37  Burkholderia pseudomallei K96243 gi|53722871||ref|YP_111856.1| putative oxidoreductase [Burkholderia pseudomallei protmod 5 .VNRQLRLKARP--DGRVGHEHFTLAE-APLPPLGPGEMLVRVLYLSMDPTNRVWMSDIP--QYLPPVAIGDVMRALGIGRVVASNAPGFAEGDLVQGLV-GWQDYAHVRADEIAQYTPAALGLPLPRLLGACGMSGLTAYYGLTEIAPVQPG--ETLVVSAAAGSVGSVAGQIGKIHG-TRVVGIAGGADKCRYLTDELGFDAAVDYKSDDWKRALKDATPDGVHVSFENVGGEIMRAVLSRMAIGGRVALCGVIANYNSGRPADDV------SVLIAKRLTMRGFLILDYRKSRE-AIATLAGWLRDGRLKAEETVADGLTNAPDVLNRLFDGSHRGKLVLRVDPQA.. 338
106  5.000e-57 31  Caulobacter crescentus CB15 gi|16126259||ref|NP_420823.1| alcohol dehydrogenase, zinc-containing [Caulobacte protmod 5 ...REIRLKARP--VGMPKDSDFELATVEL-PAPGDGEIQVKNLWMSVDPYMRGRMYDRP--SYVPPFQLGEALQGGAIGEVIASNDPDFKPGDIVSSMF-GWREAYNAHPKSLAKIETHGIPPQA--FLGVAGMPGMTAYAGLLRVAALKDGD--VVFVSAAAGAVGSIVCQIAKLKG--HTVIGSAGGPEKVAFLKSIGVDHVIDYKTPDVVAELAKVAPKGIDVYFENVGGVHLEAAINSARPFARFALCGMISQYNETSK---PEGPSNIILAVGKSLRLEGFIVSNHFDLYPQFAKDMAEWIKAGKITWKETVEDGVDRAPNAFLKLFTGENLGKMLVKLG..... 341
107  6.000e-57 35  Staphylococcus epidermidis ATCC 12228 gi|27468696||ref|NP_765333.1| quinone oxidoreductase [Staphylococcus epidermidis protmod 3 ..NEQIVFNKVP--DGMPQDDTFKYEDIDVIEP-SENELQLKTLYISVDPYMRGRM--TNADSYVDPFKQGEPFNGHTVSKVLKSKDSNFDEGDIVVGML-PWRKINTVNSEYVNKVPTS--DVPLHLYLSVLGMPGQTAYHGLLDIGQPKEG--ETVVISAASGAVGSVVGQIAKLKGC-RVVGIAGGDKKVNYLKNELRFDAGIDYKKDNFPEALKEAVPNGIDVYFENVGGYIGDEVFKHLNTHARIPVCGAISSYNHPEKDIGPR---IQQTLIKNQAMMRGFIVAEFADGFKEASKQLAQWVQENKIKTQVSVEDGFDKVPQAFRNLLTGDNFGKQVIKVASE... 334
108  7.000e-57 36  Xenopus tropicalis gi|51895861||gb|AAH81301.1| Ltb4dh-prov protein [Xenopus tropicalis] gi|56118580 protmod 3 .IAKSWTMVRH--FEGAPQPEDFKLIENEL-PPLKDGEVLLESEFLSVDPYMRPYSK--------MKLKEGDVIMGSQVARVIESKNPAVPVGGYYVAF-AGWTTHFISDGQGLAPLPSSWPNLPKSLALGAAGMPGLTAYFGLLELCNPKEGD--VVLVNAAAGAVGSLVGQIAKIKGC-KAVGCAGSDDKVGF-LKEIGFDEAFNYKTSSLAEALKKASPEGYDCYFENVGGKFADTALQQMKDFGRIAVCGAISLYNDSVPSTGPY---IQPYILFKQLRMEGFLVTRWQDRYPEGQKQLLQWIIEGKLKYHEHITNGFENMPAGFMGMLKGENIGKAIIKV...... 329
109  7.000e-57 28  Arabidopsis thaliana gi|21537356||gb|AAM61697.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 12 ..NNQVIL--RDYVSGFPKESDLYIATVDLRVPPGSMAVLVKNLYLSCDPHSRTRMGKPDPTSMAHAFTIGKPISGFGVAKAIHSCHPNYKTGDLLWGRV-GWEEYCVISPTPSSHFKIHHTDVPLSFYTGILGIPGLTAYVGFYEICSPKKGK--TVFVSAASGAVGQLVGQFAKMVGCY-VVGSASSKEKVDLPKTKFGYDDAFNYKEEDLSAALKRCFPKGIDIYFENVGGKMLDAVLQNMRTHGRIAACGMISQYNLKESEVLHN----TATIVHKRIRVQGFAAVEFFDRYSKFLDFILPHVREGKITYVEDIAQGLENGPSALIGLFHGKNVGKQLVEVARE... 353
110  9.000e-57 33  Mycobacterium avium subsp. paratuberculosis str. k10 gi|41409901||ref|NP_962737.1| hypothetical protein MAP3803 [Mycobacterium avium protmod 6 ..NRQILLRRRPS--GLVRPDDTELVTTP-APEPAEGEALLRTTYVGIDAAARTWLDD--QPSYLPPVQLGEVIRAAGIGEVVASRCDAFAVGD-VVTTLTGFQEYAIIRDDLFSTPIPGEHDQLA--IMSVYGPTGATAYFGMTDIGRPQPG--ETVVVSAAAGATGSIAGQIAKIAGA-RVVGIAGGPEKCRAVVADFGFDACIDYKNDDVAAALKQHCPRRVDVYFDNVGGPILDAVLGRLAPQARVVLCGVISSYLTGDHPGPANY----VNLLSKTALMQGFNALDQWGRFDEAFAALRKWEAEGRLHHRQTIFEGIESCVDALNGLFTGVNIGKTLVKLSEPGA. 338
111  1.000e-56 45  Caenorhabditis briggsae gi|39597367||emb|CAE59595.1| Hypothetical protein CBG03002 [Caenorhabditis brigg protmod 14 ..NKVVMFVKRPGENNPPTVDCFDVIPIDSPSEITSEQCIVRILFLSVDPAQRCRMNTSTGVDYLGPYEIGEPVDGEGVGIVERAGSSTLQVGDLVTGCLWTWTKYFVVDSTDLVKVNLPSTFSP-SVILSCAGLSGITALLGIRKKAKIDRTRPQTIVVSGAAGSCGSLAGQIARIEGCTTIIGICGSDEKCKVLKEEFGFDAAINYKTEIISERLDRLAPDGVDIYWDNVGGRVSDEVIEMMNPNSRIVLCGQIAVYNTDLPYPPPLPDHTVQILKERNIERERYLVLTYKDEMDEAIAQLSEWLQQDRIKVKETIYDGLASAPHAFVDMMTGKNIGKMLIR....... 360
112  2.000e-56 28  Arabidopsis thaliana gi|9758497||dbj|BAB09043.1| allyl alcohol dehydrogenase; NADP-dependent oxidored protmod 12 ..NNQVIL--RNYVSGFPKESDLYITTVDLRVPPGSMAVLVKNLYLSCDPFSRIRPDPSSPASVARAYSIGKPISGFGVAKAIDSCHPNYKTGDLLWGRV-GWEEYSVITPTPSSHFKIHHTDVPLSFYTGLLGIPGLTAYVGFYEICSPKKG--ETVFVSAASGAVGQLVGQFAKMAGCY-VVGSASSKEKVDLLKTKFGYDEAFNYKEEDLSAALKRCFPEGIDIYFENVGGKMLDAVLENMRTHGRIAACGMISQYNLKEPEGVHNLASI----VYKRIRVQGFAAVEFFDKYSKFLDFILPYVREGKITYVEDIAQGLENGPSALIGLFHGKNVGKQLVAVARE... 353
113  3.000e-56 30  Arabidopsis thaliana gi|15218717||ref|NP_176734.1| allyl alcohol dehydrogenase, putative [Arabidopsis protmod 9 ..NKKVILKN--YVDGIPTETDMEVETIELKAPKGSSCFLVKNLYLSCDPYMRGRMRDFHG-SYLPPFVPGQRIEGFGLARVIDSDDTNYKPGDIVSGII-GWEEYSLLSSDNLQLRNIQLDDDPLSYHLGLLGMAGFTAYAGFNEICCPKKGDSV--FVSAACGAVGQLVGQLAKLHGCY-VVGSAGSKQKVEILKNELGYDEAFNYKEEDLDTALKRYFPEGIDIYFDNVGGSMLDAALLNMKVRGRIALCGMVSLQSLSTSSQGIK---NLYSAIYKRLRLEGFLQSDYLHIFPQFLENVKRYYKEGKIVYVEDISEGLDLAPAALVGLFSGKNIGKQVVRVAKE... 350
114  4.000e-56 31  Arabidopsis thaliana gi|21595408||gb|AAM66098.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 5 .INKQVVLLD--YVTGFAKESDLVITTIDLRVPKGSMTALVKNLYLSCDPYMRNRMRKPDPLSPATAFTPGKPISGFGVSKVIDSGHSDYEEGDLIWGAV-GWEEYSVITPIPNLHFKIHHTNFPLSYYTGLLGMPGMTAYVGFYEICTPKKGD--TVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKEKVDLLKNKFGFDDAFNYKEENLIGALKRCFPEGIDIYFENVGGKMLDAVILNMRPHGRIAACGMISQYNLKNPEGIYGLSLIT----YKRIRIEGFNCFDYFHKYSEFLEFVVPYIKEGKIKYVEDVADGLESAPAALVGLFHGKNVGKQLVLVSPS... 346
115  5.000e-56 38  Rattus norvegicus gi|20302022||ref|NP_620218.1| leukotriene B4 12-hydroxydehydrogenase [Rattus nor protmod 4 ..AKTWTLKKH--FEGFPTDSNFELRTTEL-PPLNNGEVLLEALFLSVDPYMRVAAKKLKE---------GDSMMGEQVARVVESKNSAFPTGTIVVALL-GWTSHSISDGNGLRKLPAEWPDLPLSLALGTVGMPGLTAYFGLLDICGLKGG--ETVLVNAAAGAVGSVVGQIAKLKGC-KVVGTAGSDEKV-AYLKKLGFDVAFNYKTKSLEEALRTASPDGYDCYFDNVGGEFSNTVILQMKTFGRIAICGAISQYNRTGPCPPGPSPEVIIYQ---QLRMEGFIVTRWQGEVRQALTDLMNWVSEGKIRYHEYITEGFEKMPAAFMGMLKGDNLGKTIVK....... 328
116  6.000e-56 38  Geodia cydonium gi|14041150||emb|CAC38761.1| leukotriene B4 [Geodia cydonium] protmod 5 ..IRKYVL--RSHFSGFPQRDALEIVE-EELPPIKDGEFLCEAQWISVDPYMR---------PYTSRLPLGITMIGTQVAKVVESKNDKYSPGDLVSSNF-GWVTHTISDGVQVLKLDPAIHSSP-STALGVLGMPGATSYFGFLEICQPKKG--ETLVVNGGAGAVGSLVGQIAKLKGC-RVVGFAGSDAKVKYMLD-LGFDAAYNYKTESLDAAIKESCPNGVDLFFDNVGGEFFEVTLSNMNEFGRVSVCGAISLYNATEK---PKFRSVSEIILFKQLKVEGFIVARWLDQWPKAFKEISEWIKEGKVKYDEHVTEGFDNMFDAFAGLFTGDNTGKAIVKI...... 335
117  1.000e-55 32  Novosphingobium aromaticivorans DSM 12444 gi|48848074||ref|ZP_00302321.1| COG2130: Putative NADP-dependent oxidoreductases protmod 9 ...RQITLARRP--TGIPVPEDFALVEVP-RPVPGPGEILVRMRVGSCDPAIRGFLDDRP--SYLPPVALGAPINGMSLGEVIESNNPDWPVGTL-LRTFAVWSEYYVVGADALIEKVEQAPGVPLQHYMGALGPVGLTAWVGLFEIGKAKAG--ETVLVSAAAGATGSTVVQLAKAAGC-RVIGLAGGPDKARL-VRELGADVAIDYKAADLGAAIEEAAPDGIDVYFDNVGGETLDAVLPLMRLHGRIAVCGMIAQYNDA--DNPHGNRNLW-QLVVNRLTMRGFITYDHPEVLGEAQAMLDRLFAEGKLKPLENVREGLEKLPEAFIDLMSGRTTGKTLVLV...... 339
118  1.000e-55 36  Oncorhynchus mykiss gi|51235586||gb|AAT98594.1| leukotriene b4 12-hydroxydehydrogenase/15-ketoreduct protmod 3 .VSKAWTL--RQHFQGFPKASDFHLRE-ETLPLPKNGQVLLEAVFLSVDPYMRPYSQ--------TMMKEGDVMIGSQVAKVIQSYNPSFPVGCHVVS-DCGWRSHWVCDGAELTPVPDWPQDIPLSLALGAIGMPGLTALYGLEEVCEIKKG--ETLLVNAAAGAVGSVVGQIAKIKGC--RVVGCAGTDSKVSYLKELGFDQVFNYKTTSLEESLREAAPHGYDCYFENVGGKFSSVVMPQMREYGRIAVCGSISMYNDTTPQTGPY---VHTHMIFKQLRMEGFLCARWKHKHQQSLRRLMAWMTEGKLRCNEHITIGFNNMPAAFMGMLQGDNTGKAVVKV...... 329
119  2.000e-55 36  Danio rerio gi|56269609||gb|AAH86722.1| Zgc:101689 [Danio rerio] gi|56693373|ref|NP_00100865 protmod 4 ..AKVWVLKQH--FDGFPKDSDFELK-VEQLSEPANGEVLLEALFLSVDPYMRPFSSFRMKAE--------DVMIGTQVAKVIKSNNPSFPVGCHVVGR-SGWRTHTLSDGSDLTKIDDWPHDVSLSRALGAIGMPGLTALYGLEEVCAIKPG--ETLLVNAAAGAVGSVVGQIAKLKGCK--VVGSAGGDDKVAYLKELGFDQAFNYKTPSLEEALKNASPEGYDCYFESVGGHFSSVAIPQMKDLGRIAVCGAISLYNDSTPQTGPYQQMTMIV---KQLKMEGFLVGRWEHKNEESLKRLLTWMQEGKLKCKEHVTVGFENMPAAFMGMLKGDNIGKAIVKV...... 329
120  2.000e-55 29  Mentha x piperita gi|34559418||gb|AAQ75423.1| (+)-pulegone reductase [Mentha x piperita] protmod 3 .MNKQIVLNN--YINGSLKQSDLALRTSTICMEIPDGAILVKNLYLSVNPYLILRMGKLDIPQFDSILP-GSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLINPYNLFKIQDK--DVPLSYYVGILGMPGMTAYAGFFEICSPKKG--ETVFVTAAAGSVGQLVGQFAKMFGCY-VVGSAGSKEKVDLLKNKFGFDDAFNYKEEDYDTALKRHFPEGIDIYFDNVGGKMLEAVINNMRVHGRIAVCGMVSQYSLKQPEGVHNL----LKLIPKQIRMQGFVVVDYYHLYPKFLEMVLPRIKEGKVTYVEDISEGLESAPSALLGVYVGRNVGNQVVAVSRE... 342
121  2.000e-55 31  Oryza sativa (japonica cultivar-group) gi|34907532||ref|NP_915113.1| putative allyl alcohol dehydrogenase [Oryza sativa protmod 12 ..NRKVVL--REYIAGRPREDDMVLVDRVPEAAAPAPAVLVKNLYLSCDPYMRGRMRDFHG-SYIPPFKPGSVIEGLGVARVVDSTHPGFSAGDIVSGM-TGWEEYSLIDPEQLSKI--QQSDIPLSYHLGLLGMPGFTAYAGFYEICSPKKG--EFVFVSAASGAVGQIVGQLAKLHGCY-VVGSAGTNQKVELLKGKFGFDAAFNYKEEDLTAALKRYFPEGIDIYFENVGGPMLDAVLLNMRTHGRIAVCGMVSQNALTDPVGIHN----IFCLVPKRIRMQGFIQSDHLHMFPQFVSDMAKHYRDGKIVYVEDMSIGLENAPAALVGLFSGKNVGKKVVCVSQELS. 355
122  3.000e-55 35  Xenopus laevis gi|56269522||gb|AAH87387.1| LOC495998 protein [Xenopus laevis] protmod 3 .VTKSWTMVRH--FEGAPKAEDFKLIEKEL-PTLKDGEVLLESEFLSVDPYMRPYSKQQ--------LKEGDVMMGSQVARVVESKNSAFPVGGYYVA-YAGWTTHFISDGKGLDALPSNWPDLPRSLALGAVGMPGLTAYFGLLEVCNPKQG--EVVLVNAAAGAVGSVVGQIAKIKGC-KAVGSAGSDDKLGF-LKEIGFDEVFNYKTSSLAEALKKASPEGYECFFDNVGGKFTDAALQQMKDFGRIAVCGAISLYNDSVPSTGPY---IQPYILFKQLRMEGFFDSRWQDRFPEALKQLLQWVVEGKLKYREHITNGFENMPAGFIGMLKGENIGKAIIK....... 328
123  3.000e-55 37  Xenopus tropicalis gi|56270380||gb|AAH87566.1| Hypothetical LOC496616 [Xenopus tropicalis] gi|58332 protmod 3 .VAKSWTMVRH--FEGAPKPEDFKLVNTEL-PSLKDGELLLESEFLSVDPYIRPYSKEK--------LKEGDIILGSQVARVVESNNAAFPVGGYYVA-YAGWTTHFISDGTGLDALPSNWPDLPRSLALGAVGMPGVTAYYGLLEICKPKEGD--VLLVNAAAGAVGSLVGQIGKIKGC-KVVGSAGSDEKLTF-LKEIGFDEAFNYKTSSLAEALKTASPEGYDCYFDNVGGKFSDAALQQMKDFGRITVCGAISQYNDSVP---PSGPYIQPYILFKQLLMQGFLVWTWKNRYPEAQKQLLQWIAEGKLKYHEHITNGFENMPAGFIGMLKGENVGKAIIIV...... 329
124  4.000e-55 31  Arabidopsis thaliana gi|9755697||emb|CAC01709.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 5 .INKQVVLLD--YVTGFAKESDLVITTIDLRVLKGSMTALVKNLYLSCDPYMRNRMRKPDPLSPATAFTPGKPISGFGVSKVIDSGHSDYEEGDLIWGAV-GWEEYSVITPIPNLHFKIHHTNFPLSYYTGLLGMPGMTAYVGFYEICTPKKGD--TVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKEKVDLLKNKFGFDDAFNYKEENLIGALKRCFPEGIDIYFENVGGKMLDAVILNMRPHGRIAACGMISQYNLKNPEGIYGLSLIT----YKRIRIEGFNCFDYFHKYSEFLEFVVPYIKEGKIKYVEDVADGLESAPAALVGLFHGKNVGKQLVVVSPS... 346
125  6.000e-55 34  Yarrowia lipolytica CLIB99 gi|49647373||emb|CAG81807.1| unnamed protein product [Yarrowia lipolytica CLIB99 protmod 5 ....RVTLQQHPKTTIEP--STFKDETVPIPDDLKDGDYLIKVKLVSLDPTLRGQMSG--QKSYIEPVKLGDVMRAWGLGEVVESKNPEYKVGDIVSGVV-GFSEYAIGHNQDHRKIP-NIPGIPLEDNLGVLGLTGLTAWWGINGVAG-GIKSGETVLVSGAAGATGSVAGQLAKIAGA-KVIGIAGGKDKCDFITKELGFDVALDYKSADFKKDFKEATKGGVDVYYDNVGGEILDMALMAANDFARFIMCGGISQYNLDKPQPL----YNVLQVVPKRIKMQGFIVMDHGDRFPEIIKDLAGLISQGKLKAKTHIEGPVTGLPNALKSLFEGANTGKMIYKLD..... 337
126  9.000e-55 39  Mus musculus gi|15928811||gb|AAH14865.1| Leukotriene B4 12-hydroxydehydrogenase [Mus musculus protmod 4 ..AKSWTLKKH--FEGFPTDGNFELKTTEL-PPLNNGEVLLEALFLSVDPYMRVAAKKLKE---------GDRMMGEQVARVVESKNSAFPKGTIVAALL-GWTSHSISDGNGLTKLPVEWPDLPLSLALGTVGMPGLTAYFGLLDICGVKGG--ETVMVSAAAGAVGSVVGQIAKLKGC-KVVGTAGSDEKV-AYLKKLGFDVAFNYKTKSLEEALRTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQYNRTGPCPQGPAPEVVIYQ---QLRMEGFIVNRWQGEVRQALTELMNWVSEGKVQYHEHVTEGFEKMPAAFMGMLKGENLGKTIVK....... 328
127  1.000e-54 39  Mus musculus gi|13385466||ref|NP_080244.1| leukotriene B4 12-hydroxydehydrogenase [Mus muscul protmod 4 ..AKSWTLKKH--FEGFPTDGNFELKTTEL-PPLNNGEVLLEALFLSVDPYMRVAAKKLKE---------GDRMMGEQVARVVESKNSAFPKGTIVAALL-GWTSHSISDGNGLTKLPVEWPDLPLSLALGTVGMPGLTAYFGLLDICGVKGG--ETVMVSAAAGAVGSVVGQIAKLKGC-KVVGTAGSDEKV-AYLKKLGFDVAFNYKTKSLEEALRTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQYNRTGPCPQGPAPEVVIYQ---QLRMEGFIVNRWQGEVRQALTELMNWVSEGKVQCHEYVTEGFEKMPAAFMGMLKGENLGKTIVK....... 328
128  2.000e-54 37  Cavia porcellus gi|12248802||dbj|BAB20289.1| leukotriene b4 12-hydroxydehydrogenase/prostaglandi protmod 4 ..AKSWTLKKH--FQGKPTQSDFELKTVEL-PPLKNGEVLLEALFLSVDPYMRIASKRLKE---------GAVMMGQQVARVVESKNSAFPAGSIVLA-QSGWTTHFISDGKGLEKLLTEWPDLPLSLALGTIGMPGLTAYFGLLEVCGVKGG--ETVLVSAAAGAVGSVVGQIAKLKGCK--VVGAAGSDEKIAYLKQIGFDAAFNYKTVNLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDQLPPGPSPE---SIIYKQLRIEGFIVYRWQGDVRKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT....... 328
129  2.000e-54 37  Cavia porcellus gi|51247895||pdb|1V3V|B Chain B, Crystal Structure Of Leukotriene B4 12- Hydroxy protmod 8 ..AKSWTLKKH--FQGKPTQSDFELKTVEL-PPLKNGEVLLEALFLSVDPYMRIASKRLKE---------GAVMMGQQVARVVESKNSAFPAGSIVLA-QSGWTTHFISDGKGLEKLLTEWPDLPLSLALGTIGMPGLTAYFGLLEVCGVKGG--ETVLVSAAAGAVGSVVGQIAKLKGCK--VVGAAGSDEKIAYLKQIGFDAAFNYKTVNLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDQLPPGPSPE---SIIYKQLRIEGFIVYRWQGDVRKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT....... 332
130  2.000e-54 38  Mesorhizobium loti MAFF303099 gi|13475704||ref|NP_107271.1| quinone oxidoreductase [Mesorhizobium loti MAFF303 protmod 6 ..NIRIVLAARP--QGRPKPSDFRIESVGIAEP-GEGELLLQILYLSLDPYMRGRMN--ATKSYAKPVEIDGVMEGGTVARVVKSRHAGFAEGDIVLS-HSGWQGFALSDGVGLRKLDPAA--APVTTALGVLGMPGFTAYAGLLTIGQPKAG--ETVVVAAASGAVGSAVGQIARIKGA-RAVGIAGGADKCAFVRRELGFDAVVDHRADNFAEQLKAACPDGIDVYFENVGGPVWDAVFPLLNEFARVPVCGLIAQYNTVAASADDRLPTLMQQVLHRSLTIRGFIQREFVDQRPAFYRDMAGWIASGQVRYREDIVDGLENAPQAFMGLLEGKNFGKLIVRVA..... 338
131  3.000e-54 31  Chromobacterium violaceum ATCC 12472 gi|34102117||gb|AAQ58484.1| probable zinc-containing alcohol dehydrogenase [Chro protmod 6 .....IHLIRRP--TGMPSADLFALEEVAL-PKLQTGQALIENLYLSVDPYMRECMDLEEE------WPLHTPLEGRSIGRVIDAGSSGLNVGELVFHRE-GWRSHAAVAAEEL-RVLKEYPGVSASAFLSIMGGTGLTAYVALSRIAKLQAG--EDIFVSAAAGGVGSAIAQLARLMGAGRLIGSTGSAAKARYLTETLDYDFAIDYHSQDLSQALGEAAPEGFDIYIDNVGGKHQEAAIRHIRDHGRIAWVGAVGQYNHAES---PELARNLYDIVGKSLRLEGFLVRNYRHLQDELEAFVVPHLQSGRLQPQQTVREGLENMAQAFVDMLAGANLGKMLIKLA..... 330
132  4.000e-54 37  Rubrivivax gelatinosus PM1 gi|47575250||ref|ZP_00245285.1| COG2130: Putative NADP-dependent oxidoreductases protmod 6 ..NRQLLLARHP--EGRIRDEDFRLVDAPLAP-LADGQVQVRTIYLSIDPTMRVWLHPTD--NYLPMIQPGEVFRGIGIGVVEATRHPGFAQGTLVQGLF-GCQQRVISDGSDLL-VLSDIAPLPVTAHFSLLGHIGMTAYCGLVKVGAAKAG--ETLLVSGAAGAVGALVGQIGRILGC-RVVGVAGGAEKCRYLTEVLGFDAAVDYRAADFDASLAAACSKGIDVYFDNVGGHTLELALGLMNDFGRIVCCGMISTYNDYDVPGPRN----IVQVVLKRLRMQGFVILDPEHDPKEAYAHLLQWAGEGRLQHRAHVVEGLERVPDAINMLLDGRNQGKLMVRLSDEPA. 339
133  5.000e-54 36  Gibberella zeae PH-1 gi|42551684||gb|EAA74527.1| hypothetical protein FG10920.1 [Gibberella zeae PH-1 protmod 5 ..NLEIVLAERPTTDIIPGR-TFTQKTAPTPADLQDGQILVETLYLSLDPAMRGWLRD--MRSYLPPVQIGETMRGSCACRVIASKSKLAKEGDIVAATP-GWTEFAIVPEGRFEPASYYPGVQDPKDMLSALGMTSLTAWVGMAKIADPQPG--ELVVVSGAAGATGSVAGQIAKLKGAT-VVGIAGGEDKCKWLTEELGFDVALNYKADDFKEKFNEATKNYIDVYYDNVGGDILDMCLMRAKEHARFIECGLVSQYNAAKPQGPRAFSQIVTM----RIKMQGFIVLDHAKDFATARADLAKWMSEGKLKKTETVIRGLKVAEQALVDLYKGINTGKLIVEI...... 339
134  6.000e-54 28  Schizosaccharomyces pombe gi|13624910||emb|CAC36904.1| SPAPB24D3.08c [Schizosaccharomyces pombe] gi|191149 protmod 5 ..NAVIIKKYLDSTAGYPVIGEFEKREFDLENAQVDEEVLLKNIYTSVDPYLRMRMQSPKHASYIPPLELGKPFYNSTVAKVVKSTLDQYKPGMDVV-FVSGWEEYTFVSKQALGFLQPINNPLPLIDFVGSLGMPSQTAYCGLKHIGKPKAG--ETIYISAASGAVGQMAGQLAKAMGL--HVVGSVGSDEKFKICLDSGYDSVFNYKKESPFKALPRLCPKGIDIYFENVGGETMDAVLENMNLQGRIIFCGAISQYNNPNPYRVKNLGMVLV----KSLTIQGFIVANILPQYQQYFEEMPKLIAEGKIKYKCDVYDGLESAPEAFIGMLQGKNSGKTIVKIADE... 349
135  9.000e-54 30  Arabidopsis thaliana gi|20466157||gb|AAM20396.1| allyl alcohol dehydrogenase-like protein [Arabidopsi protmod 7 ..NKQVIL--RNYVKGIPKESDLMIITVELKVKPGSAAVMVRNLYLSCDPYILMREPTPSTLALLDAFIPGKPIAGIGVSQVIDSDDPSFTKGDMIWGIVN-WEEFSTINPAAIFKIDVNIN-VPLSYYTGILGMIGLTAYAGFFEICSPKKGD--TVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKQKVDLLLNKFGYDDAFNYKEEDLDSALKRCVPKGIDIYFENVGGKMLDAVLLNMKTYGRIAVCGMISQYHLETRDRLQNLPDI----IFKKIRMQGFASYDFIDRFPKFLEFVLPYIKEEKLAYVEDIVEGLENGPAALVGLLHGKNVGKQVLKVA..... 346
136  1.000e-53 30  Arabidopsis thaliana gi|21555641||gb|AAM63904.1| allyl alcohol dehydrogenase-like protein [Arabidopsi protmod 7 ..NKQVIL--RNYVKGIPKESDLMIITVELKVKPGSAAVMVRNLYLSCDPYILMREPTPSTLALLDAFIPGKPIAGIGVSQVIDSDDPSFTKGDMIWGIVN-WEEFSTINPAAIFKIDVNIN-VPLSYYTGILGMIGLTAYAGFFEICSPKKG--ETVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKQKVDLLLNKFGYDDAFNYKEEDLDSALKRCVPKGIDIYFENVGGKMLDAVLLNMKTYGRIAVCGMISQYHLETRDRLQNLPDI----IFKKIRMQGFASYDFIDRFPKFLEFVLPYIKEEKLAYVEDIVEGLENGPAALVGLLHGKNVGKQVLKVA..... 346
137  1.000e-53 30  Arabidopsis thaliana gi|7019678||emb|CAB75803.1| allyl alcohol dehydrogenase-like protein [Arabidopsi protmod 7 ..NKQVIL--RNYVKGIPKESDLMIITVELKVKPGSAAVMVRNLYLSCDPYILMREPTPSTLALLDAFIPGKPIAGIGVSQVIDSDDPSFTKGDMIWGIVN-WEEFSTINPAAIFKIDVNIN-VPLSYYTGILGMIGLTAYAGFFEICSPKKGD--TVFVSAASGAVGQLVGQFAKLMGCY-VVGSAGSKQKVDLLLNKFGYDDAFNYKEEDLDSALKRCVPKGIDIYFENVGGKMLDAVLLNMKTYGRIAVCGMISQYHLETRDRLQNLPDI----IFKKIRMQGFASYDFIDRFPKFLEFVLPYIKEEKLAYVEDIVEGLENGPAALVGLLHGKNVGKQVLKINPNSS. 353
138  2.000e-53 35  Nocardia farcinica IFM 10152 gi|54027241||ref|YP_121483.1| putative dehydrogenase [Nocardia farcinica IFM 101 protmod 19 ...REFLLAARP--DGVPTADNFALVTRPVPEP-APGQVLVRNTWMSVDPYMRGRMDDRP--SYIEPFRLGAPLEGSAVGEVIASRAPAVPVGTTVTHF-AGWRDYAVLDATAVTPVDPDL--APPWQYLGALGTTGLTAYAALTDVAPVRPGD--TVFVSAAAGAVGSVAGQLAKLLGAGRVIGAAGGPAKTALLREEFGFDAALDHRAGDLAGQLAAAAPEGIDVYLDSVGGGHLRVAVEAMRPRGRIALVGAISGYNGAAAEPGPDL----FKAATREVSLRGMLVNSYFDRFGEYIGKAAGWLARGELRTRQTVHEGLEQAPTALLGVLSGANVGKMLVRLAD.... 348
139  2.000e-53 34  Tetraodon nigroviridis gi|47215757||emb|CAG05768.1| unnamed protein product [Tetraodon nigroviridis] protmod 4 ..AKSWILTKH--FDGFPNDSNFELK-VEELVEPKDGEVLLEAVFLSVDPYMRPFSALRMK--------EGDVMIGTQVAKVVQSKNSAFPVGTHVVAR-CGWRTHTVCDGTPLTPIPKWPEDVSLSLALGTIGMPGLTALFGIEEVLKLQKG--ETLLVNAAAGAVGTVVGQIAKIKGCK--VVGSAGSDAKVAYLKELGFDEAFNYKTGSLEEALKKASPDGYDCFFENVGGPFSTVALQQMKAFGRIAVCGGIATYNDKTQQTGSYPP---LTIIFKQLKMEGFMQSRWEHKHPESLKRLMGWLKEGKLQSREHVTKGFENMPAAFMGMLRGENTGKAIV........ 327
140  3.000e-53 37  Streptomyces avermitilis MA-4680 gi|29605010||dbj|BAC69078.1| putative dehydrogenase [Streptomyces avermitilis MA protmod 12 .............................PVEEPGPGRFAGRTRVISLDPAMRGWLDDRP--SYLPPVGIGEVMRAGSVIEVTASNHPDFQPGDHVVGTF-GVQEHVVSDGKGAMKIDTSL--APPSTYLGALGMPGMTAYFGLLEVGALK--DGETVVVSGAAGAVGSMVGQIAKAKGC-RVVGIAGGPEKCALLTDELGFDAAIDYRTEDVRKALRGHAPDGIDVYFDNVGGDILDAALTRLAMHARVVVCGAISQYNNATPVKGPSNYLSLLV---RRARMEGLVVFDYAKRYPQATQEISGWIGAGHIKVKEHVVRGVDDFPETLQMLFRSENVGKLVLELA..... 318
141  4.000e-53 35  Sus scrofa gi|2947100||gb|AAC39170.1| 15-oxoprostaglandin 13-reductase [Sus scrofa] protmod 4 ..AKSWTLKKH--FVGYPTPSNFELKTVEL-PPLKNGEVLLEALFLTVDPYMRIAARKLKEGDM---------MMGEQVARVIESKNAAFPTGTIVVALL-GWTTHSISDGKNLERLLAEWPDLPLSLALGTVGMPGLTAYFGLLDICGLKGG--ETVMVNAAAGAVGSVVGQIAKLKGCK--VVGAAGSDEKVACLKKYGFDVAFNYKTESLEETLKKASPEGYDCYFDNVGGEFSNAVTSQMKKFGRIAICGAISTYNRTGPPPPGPPPE---VVIYNELCFQGFIVTRWQGEVRQALRDLLKWVSEGKIQYHEHITEGFENMPAAFMGMLKGENLGKAIVK....... 328
142  4.000e-53 91  Rattus norvegicus gi|34867385||ref|XP_216749.2| similar to RIKEN cDNA B830026H24 [Rattus norvegicu protmod 13 ............WKNGNPVAENFRVEEVSLPDTINEGQVRVRTLYLSVDPYMRCKMNEETGADYLAPWQLAQVADGGGLGVIEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHVSAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTHEKCLFLTSELGFDAAVNYKTGNVAEQLREACPDGVDVYFDNVGGDISNAVIS............................................................................................................. 242
143  4.000e-53 35  Sus scrofa gi|47523824||ref|NP_999550.1| NADP dependent leukotriene b4 12-hydroxydehydrogen protmod 4 ..AKSWTLKKH--FVGYPTPSNFELKTVEL-PPLKNGEVLLEALFLTVDPYMRIAARKLKEGDM---------MMGEQVARVIESKNAAFPTGTIVVALL-GWTTHSISDGKNLERLLAEWPDLPLSLTLGTVGMPGLTAYFGLLDICGLKGG--ETVMVNAAAGAVGSVVGQIAKLKGCK--VVGAAGSDEKVACLKKYGFDVAFNYKTESLEETLKKASPEGYDCYFDNVGGEFSNAVTSQMKKFGRIAICGAISTYNRTGPPPPGPPPE---VVIYNELCFQGFIVTRWQGEVRQALRDLLKWVSEGKIQYHEHITEGFENMPAAFMGMLKGENLGKAIVK....... 328
144  6.000e-53 34  Gallus gallus gi|53135802||emb|CAG32459.1| hypothetical protein [Gallus gallus] protmod 4 ..AKVWVLKKH--FEGFPKPSDFEMKQVALA-NLKDGELLLESVFLSVDPYMRPYSKRDMK--------EGDVMIGTQVARIVESKNPAFAVGTFVVA-NRGWRTHFISDGKDLNLLPAGWPSLPKSLALGTVGMPGLTAYVGLFEICKMKPG--ETVLVNAAAGAVGSVVGQLAKIGGCK--VVGCAGSDSKVAYLKNIGFDEAFNYKTASLDEALRKASPDGYDCFFDNVGGEFASIAINHMKKFGRIAVCGAISQYNDSVPQKGPY---IQIPMIFNELSMKGFIVSSWHNHREEGVKALLKWVLEGKLKYHEQVTERFENMPAAFIGMLKGENLGKAVVKV...... 329
145  6.000e-53 39  Botryotinia fuckeliana gi|3282229||gb|AAC24957.1| NADP-dependent leukotriene b4 12-hydroxydehydrogenase protmod 19 ...QSVVLAKRPTGQIVPG-ETFEKKENPMVTELKDDQVLVEVLYLSLDPAMRDR------RSYVPPVQIGEVMRGVSIGKVIASKSSKFNVGDYASGI-TGWKEVAIMASKDLTPI-ELPPNGKLTDALGVLGMTGLTAYFGILEVGKIKAGDFV--VVSGAAGATGSVVCQIAKLKGA-KVLGLAGSDDKVQ-WLKELGCDDALNYKDKEFPSKFKAATPNFIDVFFDNVGGEILELALSRAKPFSTFVMCGAISQYNSDTPVGPKNFSMIIAM----RIRLQGFIVFDYASKYAEARKEMSQWLAEGKLQRKETIVKG.............................. 321
146  8.000e-53 28  Gibberella zeae PH-1 gi|42549842||gb|EAA72685.1| hypothetical protein FG03238.1 [Gibberella zeae PH-1 protmod 8 ...KQWVLANKP--TGEPVLSTWKLQTVTLPE-LQDGQILVKIQYFSNDTGLRNFMHSTPERFYVPTVPVGSPMRSGIIAEVVESRSDKFKVGDLCMDFHLGWSEYAILEAENSQPLAPLPNGLSTTHFLGAFGASGLAAYTGLYYAGEAKP--EHTIVISAAAGATGSMAVQIAKILKAKRVIGIAGSDE-KCEWVKSIGAHECINYKSPTFLEDLKAVTPDEVDVYFDNVGGFVLDAMLTRVKRHGHIAVCGSVSVYNSDEPMALKN----WFELISSRINIRGFIMLDYMDKVPAILGELIGATADGRIKLENAETVRIEQQPETWMKLFSGVNQGKLLTKL...... 350
147  9.000e-53 33  Gallus gallus gi|50762027||ref|XP_424916.1| PREDICTED: similar to dithiolethione-inducible gen protmod 4 ..AKVWVLKKH--FEGFPKPSDFEMKQVALA-NLKDGELLLESVFLSVDPYMRPYSKRDMK--------EGDVMIGTQVARIVKSKNPAFAVGTFVVA-NRGWRTHFISDGKDLNLLPASWPSLPKSLALGTVGMPGLTAYVGLFEICKMKPG--ETVLVNAAAGAVGSVVGQLAKIGGCK--VVGCAGSDSKVAYLKNIGFDEAFNYKTASLDEALRKASPDGYDCFFDNVGGEFASIAINHMKKFGRIAVCGAISQYNDSVPQKGPY---IQIPMIFNELSMKGFIVSSWHNHREEGVKALLKWVLEGKLKYHEQVTERFENMPAAFIGMLKGENLGKAVVKV...... 329
148  2.000e-52 35  Neurospora crassa gi|32421263||ref|XP_331075.1| hypothetical protein [Neurospora crassa] gi|289214 protmod 14 ....QLELVHRPSGPIIPGH-TFRVVPAPVPSDLNEGDLLLETLYISLDPAMRGWLDD--VRSYVPPVQIGEVMRAFCICRVLASRSPKAAAGDIVTAMN-GIREIGILSDRHIEKPAFLPPGGKTTDLLGVLGMTGLTAYFGMMKIGNVKRGD--TVVVSAAAGATGSVAVQIARIQGAKRVVGTAGSDEKCRWLVEEGGADVALNYKDPEFRRKFKEATPDFVDVYFDNVGGEQLNMALARANRGARFVMCGGISQYNAEHKQGPKVGGFHLLGTISMRIRMEGFIVFDYKDEYPTALGQLAQWLAEGKLKRKETILKGVRVADEGMVQLYKGGNIGKLLIEVKNPD.. 372
149  3.000e-52 37  Anopheles gambiae str. PEST gi|55243530||gb|EAA06505.2| ENSANGP00000012490 [Anopheles gambiae str. PEST] gi| protmod 32 ..ARKWIYAK--AFQGEPHHGNFRLETEPLPATLQPGEFLAQAEYLSVDPYMR---------PYMLAYPEGSLMIGGQIARVTRSENAHFPVGATVFGQF-GWRTHTVCDPARLEKVLPDFGGLPTSLGLGILGMPGNTAYFGLQELCQPQPG--ETVVVSGAAGAVGSVVGQIAKIKGC-RAVGIAGT-EEKCEWLRKIGFDAAINYKRNDVYGELKKAAPRGVDCYFDNVGGSVTETVLKQMNVYGRIAVCGAISNYNSAVGKVTDPQRQF----VFKQLRMEGFLVWRWNDRWLEGIEGNLRWIREGRLAYEETVTEGFERMPDA....................... 341
150  5.000e-52 32  Oryza sativa (japonica cultivar-group) gi|51090889||dbj|BAD35462.1| putative allyl alcohol dehydrogenase [Oryza sativa protmod 9 ........AVRHHVEGLPSEDDFEVKAARVRWWPESGEVLVRNLYLSVDPYQLNRMKRRSASHAVDGIVPGERIDAYGAGEVVASACEEYKEGDVVAGVL-GWEDYTLSPGVLMSKLAAS-DDLPLSHHLSALGTSGMTAYAGLYEVGRPEAG--EKVFVSAASGSVGSLVGQFAKLAGCY-VVGCAGTNAKVDLLKNKLGFDDAFNYKDEDMKSALKRYFPDGIDIYFDNVGGETLEAALANMNTYGRVALCGVISEYTDAGHRAVPDLLEV----IYKRITIRGFFAWDFLTRFAEFTGVISDWIRQGKVQVIEDISDGLESVPSAFAALFSGDNIGKKMVKLA..... 342
151  9.000e-52 21  Pseudomonas syringae pv. tomato str. DC3000 gi|28855598||gb|AAO58657.1| oxidoreductase, zinc-binding [Pseudomonas syringae p protmod 12 ...................ASTLVLEDVP-SPEIKKNEILLDVHAAGVNFPDTLIIEGKY--QFKPPFPFSPGGEAAGVIAAVGENVSHLKPGDRVMALWGSFAEQVAVPHYNVLPIPESMDFTTAAAFSMTYG----TSMHALKQRANLQPG--ETLLVLGASGGVGLAAVEIGKALGA-RVIAAASSSEKL-EVARNAGADELINYSETSLKDEVKRLTQGGADVIYDPVGGDLFDQAIRTIAWNGRLLVVGFASGRIPELPINLALLKGASVVGVFWGSFAQRQSQDNAAN-----FTQLFAWFEEGKLKPLVSTVYPLERAGEAIDLLGGRRAVGKVVVLVN..... 325
152  4.000e-51 20  Anabaena variabilis ATCC 29413 gi|46134993||ref|ZP_00162231.2| COG0604: NADPH:quinone reductase and related Zn- protmod 7 ...................PEVLQLQEVPNPSPVGSTELLVRLVAAGINPIDTKLRKRGTFYPEKMPAILGC--DGAGIVEAVGAGVQSFGAGDAVYFCNGGYAEYTVVDERFVARKPASLTFAEAA----AAPLVLITAWEALYERGRLEPG--EKVLIHAGAGGVGHVAIQLAKLKGAT--VATTVGSEDKAHFVKQLGADHVIFYKNTDFAQAALNWTNGGVDLAFDTVGGDTFHKTFPAVRIYGDIVTI----LEPDANTVWKVARNRNLRIGLELMLTPMFLNLVEAQQHQAEILTECADWIDQGKLKIHVSHKFPLQDAAKAHQLLESGSIAGKIVLLISDE... 330
153  5.000e-51 35  Oryctolagus cuniculus gi|2498510||sp|Q28719|LB4D_RABIT NADP-dependent leukotriene B4 12-hydroxydehydro protmod 4 ..AKNWTLKKH--FHGHPTDSDFELKTVEL-PPLNNGEVLLEALFLSVDPYMRLGSKRLKE---------GDTMMGQQVARVVESKNPAWPVGTLVLA-HSGWASHSISDGQQLEKLLTEWPDLPLSLALGTVGMPGITAYFGLLEICGAKSGD--TVLVNAAAGAVGAVVGQIAKIKGC--RVVGAAGSEEKVDYLKKIGFDFAFNYKTKSLEETLKKAAPDGYDCYFDNVGGEFSNTVIRQMKKFGRVAICGAISMYNSTGQLPPGPSPESVLYQ---EIRMEGFIFNRWKGEVQKALKELLTWVLEGKIQYREFVIEGFENMPAAFMRMLKGENVGK-----ARSESL 330
154  9.000e-51 32  Magnaporthe grisea 70-15 gi|38105017||gb|EAA51497.1| hypothetical protein MG10413.4 [Magnaporthe grisea 7 protmod 5 ..NTSVVLAERPKPKIIPGK-TFKVQPAPTEADLKDGQILAETLYIGLDPAMRGWLND--ARSYVPPVQIDEVMRAAAVCRVLASRSKLAKRGDLVSGMP-GWQEISILSEDAPFAVPPNGRPTDM---LGVLGMTGLTAYMGVKHVAAIKPGD--TVVVSGAAGATGSVVGQMAKHYGAGRVVGIAGGEDKCRWLVEELGFDAAIDYKAPDFKKKFAEATKGFIDVYWDNVGGEILDLALARAKKHARFVMCGGISTYNDSANEVRGPKNINMVIAM--SIRMQGFIVFDYIKEYAQARQDLAKWLQEGKIKRGETIVKGMDVIEQTLVDLFNGVNKGKLLVEVKNPDS. 351
155  2.000e-50 20  Nostoc punctiforme PCC 73102 gi|53688200||ref|ZP_00109484.2| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ..............TAAGSPEVLQVQEVPPAVPVGNTELLVRLVAAGINPIDTKLRSRGTFYPDRTPTILGC--DGAGVVEAAGAGVQRFRPGDEVYFCYGGYAEYSVVDERFVARKPASISFTEAA----AAPLVLITAWEALYERGRLLPG--ERVFIHAGAGGVGHVAIQLAKLKGAT--VATTVSSEEKANFVKELGADHVIFYKQTDFVQAVLDWTGGGVDLAFDTVGGETFHKTFPAVRVYGDIVTILEPDANTVWKTARLRNLR----IGLELMLTPALLGLEDILQHHAEILEQCATWIDEGKLKIHVSHEFPLKEAAKAHQLIESGSVTGKIVLLISD.... 329
156  4.000e-50 22  Pseudomonas fluorescens PfO-1 gi|48731061||ref|ZP_00264807.1| COG0604: NADPH:quinone reductase and related Zn- protmod 12 ...................AESLVLEDVA-SPVAKKNEILLDVHAAGVNFPDTLIIEGKY--QFKPPFPFSPGGEAAGVVSEVGEKVSHLKVGDRVMALWGSFAEQVAVPGYNVLPIPPSMDFNTAAAFSMTYG----TSMHALKQRGNLQPG--ETLLVLGASGGVGLAAVEIGKAMGA-RVIAAASSAEKL-AVAKAAGADELINYSETSLKDEIKRLTDGGADVIYDPVGGDLFDQAIRAIAWNGRLLVVGFASGRIPELPVNLALLKGAAVLGVFWGSFAQRQPQDNAAN-----FQQLFGWFAEGKLKPLVSQVYPLGNAAQAINDLGQRKAVGKVVVQV...... 324
157  4.000e-50 21  Pseudomonas syringae pv. syringae B728a gi|46189053||ref|ZP_00124204.2| COG0604: NADPH:quinone reductase and related Zn- protmod 12 ...................ASTLVLEDVP-GPAIKKNEILLDVHAAGVNFPDTLIIEGKY--QFKPPFPFSPGGEAAGVIAAVGENVSHLKPGDRVMALWGSFAEQVAVPHYNVLPIPQGMDFTTAAAFSMTYG----TSMHALTQRARLQPG--EILLVLGASGGVGLAAVEIGKALGA-RVIAAASSAEKL-EVARNAGADELINYSETSLKDEIKRLTHGGADVIYDPVGGDLFDQAIRSIAWNGRLLVVGFASGRIPELPVNLTLLKGASVVGVFWGSFAQRQPQDNAAN-----FKQLFAWFEEGKLKPLVSTVYPLERAGEAIDLLGGRRAVGKVVVLIGKTA.. 328
158  6.000e-50 20  Nostoc sp. PCC 7120 gi|17132042||dbj|BAB74647.1| alr2948 [Nostoc sp. PCC 7120] gi|17230440|ref|NP_48 protmod 2 ....KAVLMTAPGN-----PEVLQLQEVPNPVPVGSTELLVRLVAAGINPIDTKLRKRGTFYPEQMPAILGC--DGAGVVEAVGAGVQGFRVGDAVYFCNGGYAEYTIVDERFAAHKPASLTFAEAA----AAPLVLITAWEALYERGRLEP--KERVLIHAGAGGVGHVAIQLAKLKGA--IVSTTVGSEDKANFVKQLGADHVILYKNTDFAQAALDWTNGGVDLAFDTVGGETFHKTFPAVRIYGDIVTI----LEPDANTVWKVARNRNLRIGLELMLTPMLLNLVEAQQHQAEILTECADWIDQGKLKIHVSHKFPLQDAAKAHQLLESGSIAGKIVLLISDE... 335
159  7.000e-50 30  Gibberella zeae PH-1 gi|42547386||gb|EAA70229.1| hypothetical protein FG00150.1 [Gibberella zeae PH-1 protmod 1 .MVQNKTLVYKKIPTGLPVAEHLVTEDRPIIESAPEGGLVLEVQYASFDPYLRGKMRDTTVKSYAPAFEINDPIVNGTLSKVIKTDNADFVEGDLVTA-YLPIAEYVRVEKETIPKVSQNPHNLDLGLFLGPLGMPGLTAWSGLHEIGQPKKG--ETIFISSAAGAVGQIVGQIAKREGLT-VIGSVGDDAKLDFITKELGFDAGFNYKKESPKDALPRLAPNGIDIYFENVGGDHLEAALNSLNNGGRIPVCGLISEYNTPAEKREGVKGLINLIA--KQIRMEGFLVGHPRKYYKDHQESLQKWLGDGSVKAKLFVTEGIDNAADGFIGMLEGKNFGKAVLKL...... 347
160  2.000e-49 23  Rubrobacter xylanophilus DSM 9941 gi|45547267||ref|ZP_00187321.1| COG0604: NADPH:quinone reductase and related Zn- protmod 8 .............EFGGP--EVLEHVEVE-RPEPGEGQVLVEVRSAGVNYADAMRRRNR----YLAPQSLPFVPGSEVAGVVAEAGVEGVSVGERVAALVGGYAEYALVPASGLIPVPEGLGFDEAA----AIPLQGLTAYLVLRDSARLAEG--ETVLVHAAAGGVGYLAVQMARLLGARRVVATASSPEKL-EVARSLGADVLIDYTEEGWPESTEEGWPEGADVILEMVGGDFPRKNLGCLAPSGRMVVYGSASGERSEVPLLE---------LMRKQQTVSGFWLARYRGRTGEALREILSWLSSGRLRLNIGGRYPLAEAARAHADLEGRRTTGKLVL........ 333
161  3.000e-49 29  Neurospora crassa gi|32421977||ref|XP_331432.1| hypothetical protein [Neurospora crassa] gi|289203 protmod 6 ..NKTLVFKKIP--EGYPVPEHIVIEDRDPDAAPPPGGMTVSILWASFDPYQRGRMRDASVKSYAPAYQLGGPVTNDTVAKVLKSDNPDYQPGDLVVA-HLPIAEYAALTKTEVTKIDNKYGFKDLGLFLGPLGMPGLTAWSSYKEIGQPKAG--ETIFISSAAGAVGQVVGQIAKREGL-KVIGSVGAGEKLDFIINELGFDGGFNYKKEKPLDALKRLAPQGIDIYYENVGGEHLDAALECLNTFGRIVACGMISQYNVKPGEAYGVKNLIQVVA--KRLTMRGFIVFDFGPKYAKEHQEQLKWIAEGSVKFKLHVTEGIDNAPKGLVGIFKGENFGKAVLHIKDE... 362
162  3.000e-49 20  Bacillus thuringiensis serovar konkukian str. 97-27 gi|49481529||ref|YP_036273.1| quinone oxidoreductase [Bacillus thuringiensis ser protmod 2 ...KAIILTS----FGGP--EVMKYTDVDI-PAISEDQVLIRVVATSVNFADIKSRYGKKGNKALPFIPG---IDAAGIVERVGSHVKNIYPGQRVIAFNGSYAEYVVANENLTFVLPDEVDFQTAA----ACPIVSFTSYNLLANVARIQQG--ESVLIHAAAGGIGTTAIQLAKLLGAGTVIGTVGS-ETKKEIALDAGADYVIGHQDEDFVEKVNELTNGGVDVILDSISGTVSERSLKCLAYYGRLIHFGNASGEIGNFQTKDLHASCRSILGFSFGTTRK-----KRPELLQETANEVFRYLRDGRLQIKATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
163  4.000e-49 29  Candida albicans SC5314 gi|46436567||gb|EAK95927.1| hypothetical protein CaO19.11028 [Candida albicans S protmod 6 .VATQIVLKNHPAGFINPEDSTFAVKHASFPKELKEGEVIVKTLYLSNDPTQRSWSKLEKRRHYAKPIEEGSPMRSLGLGQIVQSNSSRFKPGDIVYGIIL-WGDYSVLEDTSLYNSIDTSLGLPLEYYLSVLGMTSLTAFFGLTEAGDLKPGKGPIVCVSAASGATGSVVVQIAKLLGASKVIGISGSSE-KCQWVEKLGADICVNYKDPNYQDQIEKFLGDEFDTYFDNVGGDILSFVLTKVKKFGNVVACGSIAGYNNREASKVSNWGEITV----NSLTVRGFIVTDYQEHFPKAIGILTDAVKAGKIRTDHDLIHRLENIPKIWKLFEDNKPNGKMITKVA..... 369
164  4.000e-49 35  Pseudomonas aeruginosa UCBPP-PA14 gi|46164448||ref|ZP_00137167.2| COG2130: Putative NADP-dependent oxidoreductases protmod 4 ...............................PVPADGELLLRVLYIPLDAASRAWMQ---GATYRPGLVAGEVMAGLGLAEVVESRSASFQPGDLVCA-ETGWQTFAVVPAAGLIRLP---RLEPLTHLLSVYGVAGLTAYFGLLECA--RPVQGETLAVSAAAGAVGSIVGQIARIRGC-RTVGIAGGASKCAWLVRELGFDAALDYKTGTLADDLRRTCPDGIDAYFDNTGGAILDACLPNMAEHGRVACCGAISQYDLDRPAAGP--AGIPGLLIIKRLTLRGFLLGDFLESRERALSDLKAWVDSGQIKVYEDVLYGLESLPAALVGLLNGENFGKRIVKVA..... 306
165  5.000e-49 28  Ustilago maydis 521 gi|46097559||gb|EAK82792.1| hypothetical protein UM01911.1 [Ustilago maydis 521] protmod 4 ..NHQVLFNKKPGETTKPGSAELDIDNVAL-----NGGVLTRNIAVSLDPTMRNRMKGNNGY-FSAPYVVGQPVTAIGIAEVVRSEVNDFAPGDIVYAWSTGIEDYTIHPAAAAAKFDPANNGLSITTYLGAAGMAGMTAYMSLKEIGDLKPGNK--MFVSGAAGAVGQLVVQLCHQAGVG-VIASAGSDE-KCEFVRSLGAEESINYKTEDLRAKLKAFAADGIHYYFDNVGGDQLEAYIDNAARYGIIVACGYISGYNAEKPEDVVYPKNLFNV-ITKELKYQGFIVSSYIPKWGKFMDEVPKMLADGTIKNREDVTFGVYGAEDAFLRLFTGDNSGKVAVLIDTDRA. 355
166  6.000e-49 29  Aspergillus nidulans FGSC A4 gi|40746768||gb|EAA65924.1| hypothetical protein AN0895.2 [Aspergillus nidulans protmod 4 ..NKALVFKKIP--DGYPVPEHLTIEPAAYDASAAAPAVFLQSLYTSFDPYMRGRMRSAEIKSYAPPFYLDKPIESASIAKVIRSNNGSYKEGDLVIGRL-PIQEYVAVEKDELSRIRHLENPEDIRVFLGALGMPGLTAYSSLYEIGQPKKG--ETIFVSAASGAVGQLVGQLAKHEGL-KVIGSVGSDEKLNYIINDLGFDGGFNYKKEKPADALARLAPNGIDIYYENVGGEHLEAALEAINNFGRVVVCGMISQYNSA-----PYPIKNIAYVLTKRLTMRGFIVGDMGDKYTKEHQENVQWIKDGSFKTLIHETEGIENAAEGLVGIFYGKNLGKAVLK....... 343
167  8.000e-49 18  Bacillus thuringiensis serovar konkukian str. 97-27 gi|49478983||ref|YP_037595.1| alcohol dehydrogenase, zinc-containing [Bacillus t protmod 14 ......................MRMAEVPIPE-INEHEVLAEIHAASINPIDFKIRDGKVKMLYEMPLILGNDFS--GVITKVGSKVTRFKVGDEIYARPGTFAEYIAIHEDDIALKPKNLSFEEAA----SIPLVGLTSYQALHDIMHLQKG--QKILIHAGSGGVGTFAIQLAKIMGAT---VTTTASEAGSDLVKSLGADQIINYKTEKFEEILKD-----YDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFGKEFGSGFFKTFLFSLASKKLTHNAQYSFLFMKPSGDQLRIIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKI...... 331
168  9.000e-49 29  Debaryomyces hansenii CBS767 gi|49653574||emb|CAG85959.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 8 ...KQIILNSAPSKEVGEESSTFRIEQASFDESVKDGEVVVKVLYLSNDPTQRGWMQKDAKRMYAPPILENDPVTALGLGEIVLSKSSKHSVGDKVTGRF-SWQEYVVVNEQSIFTTIDESAGLPLTSYLSSVGMTGLTAYFGVTKVGELKKG--QTIVISAASGATGSMCVQIAKHVGATKVIGISGSAE-KCKWVESLGADVCVNYHDADYQKQLSDIIGDFVDVYYDNVGGEILSFMLSKVKPFGHVVACGAIAGYNDKEKSNV----TSWAEIITNRLTVRGFIILDFVKDYAQGVGAIVGAIKEGKIKITETSVVDLTSEKDVLALFGSNKPNGKLITKIA..... 360
169  1.000e-48 21  Pseudomonas aeruginosa UCBPP-PA14 gi|32044610||ref|ZP_00141711.1| COG0604: NADPH:quinone reductase and related Zn- protmod 12 ...................ASSLVLEEIA-SPSPAKNEILLDVHAAGVNFPDTLIIEGKY--QFKPPFPFSPGGEAAGVVAAVGEKVAHVRPGDRVMALWGSFAEQVKVPGYNVMPIPEGMDFASAAAF----GMTYGTSMHALKQRANLQPG--ETLLVLGASGGVGLAAVEIGKAMGA--RVIAAASTPDKLAVAKAAGADELINYSEGSLREQLKALTGGGVDVIYDPVGGELFEEAFRSIAWNGRMLVVGFASGSIPSLPANLTLLKGASLVGVFW-----GSFAQRQPQDNADNFRQLFAWHAEGKLKPLVSQRFPLERAGDAIDALGQRKAVGKVVVEV...... 324
170  1.000e-48 28  Magnaporthe grisea 70-15 gi|38099217||gb|EAA46591.1| hypothetical protein MG08934.4 [Magnaporthe grisea 7 protmod 6 ..NKAIIFKKAP--EGFPKPEDLVIEDRPLELVAPEGGVVAQVLYASFDPYQRGRLRKPEVKSYFPAMTIGQPLENTSLLRVLESKSERFAKGDVLKHSLCPNQQYVVLSAEQIFKVEESSEF-ELAHHLGVLGMPGLTAYASLFEIGKPKKG--ETILVSSAAGAVGQVVGQLAKREGLT--VIGSVGSDDKVEYCKELGFDHVFNYKKESPDAALTRLAPNGIDIYYENVGGEHLEAALKHMNKYGRIPTCGMISEYNVK-PEDQKGIKGLMNI-VSKEITMRGFLYQSIAGPWAAKFKEVTKGLKDGSIKAKLHVVEGIENGPEGF...................... 330
171  1.000e-48 18  Bacillus thuringiensis serovar konkukian str. 97-27 gi|49479262||ref|YP_037491.1| quinone oxidoreductase (NADPH:quinone reductase) [ protmod 7 ..............HSFGDSSVFQLEEVA-KPKLLPGHVLIHVKATSVNPIDTKMRSG-AVSSVAPEFPAILHGDVAGIVIEVGEGVSKFKTGDEVYGCAGGFAEFMLADARLIAHKPKNITMEEAA----ALPLVAITAWESLFDRANIKSGQNV--LIHGATGGVGHVAIQLAKWAGAK--VFTTASQQNKMEISHRLGADVAINYKEESVQEYVQKHTNGGFEVIFDTVGGKNLDNSFEAAAVNGTVVTIAARSTHD----LSPLHAKGLSLHVTFMALK---ILHTDKRNDCGEILTKITQIVEEGKLRPLLDKSFTFDEVAQAHEYLESNKAIGKIVLK....... 328
172  1.000e-48 36  Pan troglodytes gi|55640293||ref|XP_522766.1| PREDICTED: similar to NADP-dependent leukotriene B protmod 5 ...KTWTLKKH--FVGYPTNSDFELKTAEL-PPLKNGEVLLEALFLSMDPYMRLTNERLKE---------GDTIMGEQVARVVESKNAALPKGTIVL-TSPGWTTHSISDGKDLEKLLTEWPDTPLSLALGTVGMPGLTAYFGLLEICGVKGG--ETVMVNAAAGAVGSVVGQIAKLKGCK--VVGAVGSDEKVAYLQKLGFDVVFNYKVESLEETLKKASPDGYDCYFDNVGGEFSSIVISQMKKYGRIAICGAISTYNRTGPPPPGPPPDI----IYKELRTEAFVYYRWQGERRKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK....... 327
173  1.000e-48 23  Arabidopsis thaliana gi|886434||emb|CAA89858.1| ARP protein [Arabidopsis thaliana] gi|1361983|pir||S5 protmod 304 .......................RIVRAPLQLPIGPHQVLLKIIYAGVNASDVNFSSGRYFTGGSPKLPFDAGFEGVGLIAAVGESVKNLEVGTPAAVMFGAYSEYMIVSSKHVLPVPRPDP------EVVAMLTSGLTALIALEKAGQMKSG--ETVLVTAAAGGTGQFAVQLAKLSG-NKVIATCGGSEKAKL-LKELGVDRVIDYKSENIKTVLKKEFPKGVNIIYESVGGQMFDMCLNALAVYGRLIVIGMISQYQGEKGWEPAKYPGLCEKILAKSQTVAGFFLVQYSQLWKQNLDKLFNLYALGKLKVGIDQFIGLNAVADAVEYLHSGKSTGKVVVCIDP.... 620
174  1.000e-48 23  Arabidopsis thaliana gi|30725460||gb|AAP37752.1| At1g49670 [Arabidopsis thaliana] gi|20259988|gb|AAM1 protmod 304 .......................RIVRAPLQLPIGPHQVLLKIIYAGVNASDVNFSSGRYFTGGSPKLPFDAGFEGVGLIAAVGESVKNLEVGTPAAVMFGAYSEYMIVSSKHVLPVPRPDP------EVVAMLTSGLTALIALEKAGQMKSG--ETVLVTAAAGGTGQFAVQLAKLSG-NKVIATCGGSEKAKL-LKELGVDRVIDYKSENIKTVLKKEFPKGVNIIYESVGGQMFDMCLNALAVYGRLIVIGMISQYQGEKGWEPAKYPGLCEKILAKSQTVAGFFLVQYSQLWKQNLDKLFNLYALGKLKVGIDQFIGLNAVADAVEYLHSGKSTGKVVVCIDP.... 620
175  2.000e-48 19  Bacillus cereus ATCC 10987 gi|42781260||ref|NP_978507.1| quinone oxidoreductase [Bacillus cereus ATCC 10987 protmod 9 ................FGGPEVMKYTDVDM-PVISENQVLIRVVATSVNFADIKSRYGKKGNKALPFIPGIDV---AGIVERVGSHVKNINPGQRVIAFNGSYAEYVVSNENLTFVLPDEVDFQTAA----ACPIVSFTSYNLLANVARLQQG--ESVLIHAAAGGIGTTAIQLAKLLGAGTVIGTVGS-EAKKEIPLYAGADYIICHQNEDFAEKVNELTNGGVDVILDSISGTVSERSLKCLAYYGRLVHFGNASGEIGNFQTKDLHASCRSILGFSFGTTRK-----KRPELLQATANEVFRYLRDGRLQITATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
176  2.000e-48 17  Hyla japonica gi|13699908||dbj|BAB41213.1| zeta-crystallin [Hyla japonica] protmod 6 ....RFMRAIRVNEFG--KPDVLKLMTDVPVPSPGENQVLIRVHACGINPFESYIRSGLFAWRPSLPYTPGS--DTSGVVEAVGRNVTGFKKGDRVFTITGGYAEYTVACEDMVYHLPDHLNFKQGA----ALAIPYFTAYRALFQKAHAKPG--ELILIHGASGGVGIAACQLARAYG-FKVFGTAGTPKGLNLVM-QNGAHKVFNHREKDYIEKIQEAAGGGVDVILEMLANCNLCNDLKLLSYGGRVVVLG--SQGSVDINPTDIIAKETSIIGHS--------LYSSTKEEWKEARAAIFGGMESGWLKPLIGPEYPLEKASQAHEDLTQSGATGKMVLVL...... 329
177  2.000e-48 18  Enterococcus faecium gi|48825909||ref|ZP_00287145.1| COG0604: NADPH:quinone reductase and related Zn- protmod 13 ....................DVLEQIEVPV-PKPKQGELLIKVHTAAVN---RTDIMKRESVSLKPPYP---ILGVEVAGEVVESDISTFTPGTKVYGLLGGYAEYAVMPADRAILLPDTLDYVSAAG----ISEVFLTAYQTLYWLGKLQEG--ETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL-AFCKELGADELINYKKQDFQEEVRKITEGGVDVILDFIGASYWEKNLASIAVDGRWVLIGMLGGTI--------VPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFPFLENGKIRPIIDRTFQFSAVKQAHEYMEANKNIGKIILKITE.... 327
178  2.000e-48 21  Pseudomonas aeruginosa PAO1 gi|9951543||gb|AAG08619.1| probable oxidoreductase [Pseudomonas aeruginosa PAO1] protmod 12 ...................ASSLVLEEIA-SPSPAKNEILLDVHAAGVNFPDTLIIEGKY--QFKPPFPFSPGGEAAGVVAAVGEKVAHVRPGDRVMALWGSFAEQVKVPGYNVMPIPEGMDFASAAAF----GMTYGTSMHALKQRANLQPG--ETLLVLGASGGVGLAAVEIGKAMGA--RVIAAASTPDKLAVAKAAGADELINYSEGSLREQLKALTGGGVDVIYDPVGGELFEEAFRSIAWNGRMLVVGFASGSIPSLPANLTLLKGASLVGVFW-----GSFAQRQPQDNADNFRQLFAWHAEGKLKPLVSQRFPLERAGDAIDALGQRRAVGKVVVEV...... 324
179  2.000e-48 37  Homo sapiens gi|28570172||ref|NP_036344.1| NADP-dependent leukotriene B4 12-hydroxydehydrogen protmod 5 ...KTWTLKKH--FVGYPTNSDFELKTSEL-PPLKNGEVLLEALFLTVDPYMRVAAKRLKE---------GDTMMGQQVAKVVESKNVALPKGTIVLASP-GWTTHSISDGKDLEKLLTEWPDTPLSLALGTVGMPGLTAYFGLLEICGVKGG--ETVMVNAAAGAVGSVVGQIAKLKGCK--VVGAVGSDEKVAYLQKLGFDVVFNYKTESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQ---ELRMEAFVVYRWQDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK....... 328
180  2.000e-48 37  Homo sapiens gi|12313890||emb|CAC22151.1| leukotriene B4 12-hydroxydehydrogenase [Homo sapien protmod 5 ...KTWTLKKH--FVGYPTNSDFELKTAEL-PPLKNGEVLLEALFLTVDPYMRVAAKRLKE---------GDTMMGQQVAKVVESKNVALPKGTIVLASP-GWTTHSISDGKDLEKLLTEWPDTPLSLALGTVGMPGLTAYFGLLEICGVKGG--ETVMVNAAAGAVGSVVGQIAKLKGCK--VVGAVGSDEKVAYLQKLGFDVVFNYKTESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQ---ELRMEAFVVYRWQDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK....... 328
181  2.000e-48 17  Rhodospirillum rubrum gi|48765136||ref|ZP_00269687.1| COG0604: NADPH:quinone reductase and related Zn- protmod 16 ...............GAGGPEVLKMAARPL-PVPGDGEVLIAVAAAGVNRPDVFQRQG----SYPPPPGASDLPGLEVAGTIVAIGAKGWRIGDRVCALLGGYAQYASADAALCMPVPQTLGLDEAA----ALPETFFTVWHNLFQRARLQEG--ESLLVHGGSSGIGTTAIQMAKAFGVT--VYVTAGTPEKCAACEALGADRAINYRTEDYPTVIKELTGGGVDVVLDMVGGDYIDRDLRILAEDGRHVNIAFLQGSKVTVDLMRMMLKRLTLT----GSTLRSRPATVKAGIARALEEKVWPLLEQGKLRPPIHARFALEDAAEAHRLMERSDHIGKIVLTL...... 334
182  3.000e-48 29  Cochliobolus heterostrophus gi|22000827||gb|AAM88292.1| reductase RED1 [Cochliobolus heterostrophus] protmod 4 ..NKSLIFKNPPI--GWPKPDVDFGVECRPIDINGDGGVILKNCYVSLDPYQRGRMRAPTVDSYSPPFTIGDPMEGHVISRVIRSASTKLQPGDFVSGV-GPIQEFSVLSADGFTRI-ENPYNLNLEIFLGPLGMPGLTAYSSFYEIGKPKKG--ETIFISAASCAVGQLVGQLAKREGLY-VIGSVGDDEKVEFITKGLGFDVGFNYKKEVIGEALMRVAPEGIDIYFDNVGGQTLESALYAMRPRGRIVVSGMISQYNLQPSELYGVKNLFMVITN--RITIQGFIVTD-SDMGPKYSAEHLQWIYDGSLKPKIHVDTGMDHACQSFINMLKGRKIGKAVLQIAD.... 348
183  3.000e-48 21  synthetic construct gi|49083808||gb|AAT51148.1| PA5234 [synthetic construct] protmod 12 ...................ASSLVLEEIA-SPSPAKNEILLDVHAAGVNFPDTLIIEGKY--QFKPPFPFSPGGEAAGVVAAVGEKVAHVRPGDRVMALWGSFAEQVKVPGYNVMPIPEGMDFASAAAF----GMTYGTSMHALRQRANLQPG--ETLLVLGASGGVGLAAVEIGKAMGA--RVIAAASTPDKLAVAKAAGADELINYSEGSLREQLKALTGGGVDVIYDPVGGELFEEAFRSIAWNGRMLVVGFASGSIPSLPANLTLLKGASLVGVFW-----GSFAQRQPQDNADNFRQLFAWHAEGKLKPLVSQRFPLERAGDAIDALGQRRAVGKVVVEV...... 324
184  3.000e-48 37  Anopheles gambiae str. PEST gi|55243387||gb|EAA06257.2| ENSANGP00000020750 [Anopheles gambiae str. PEST] gi| protmod 3 .VAKKWIYAK--PFEGLPKDENFRLEEETLPEPGENGWLTVRAVFLSVDPYMR---------PYMASYPAGTVMIGGQVAKVTASRHPQFPVGATVFGNF-GWRTHTLVNPEQGAAVLPPFGAHPASLGLGVLGMPGNTAYFGFLELCQPKQG--ETVVVSGAAGAVGSLVGQIAKIKGC-RVVGIAGSDDKCG-WLRELGFDATINYRRDAFADALRAAAPGGVDCYFDNVGGYISEAVLGQMNLYGRISVCGTISNYNAERAQVADPQRLF----VFKQLRQEGFIVTRWAKRWMEGIRQNLQWIEEGRLRYQETVTDGFEQMPAAFVSMLTGGNTGKAVVKV...... 361
185  3.000e-48 34  Novosphingobium aromaticivorans DSM 12444 gi|48848085||ref|ZP_00302332.1| COG2130: Putative NADP-dependent oxidoreductases protmod 4 ..NRFWRLDRHPEGSDFASALSLQTETL---PALGEGEVRVRVGWLSMDAGTRMWMSPRT-DGYQPPLPLGSKMAGLVLGRVSESRDPAFPAGTLVRGF-GQWADYAVVPASGLEAVDDGIAD--IRQHFGALGMNAWTAFVGVREVAAISPG--EWLVVSAAAGATGSMACQVGRNLGA-KVVGIAGGAEKCRYLVEELGVDIAIDYKNEDVAARLAE-VPGGVNAYFDNVGGPMLDAVLPNMAHYGRVAVCGMVAAYDNDAPLPGPARFDQVLM---RRLRIEGFFIPDFLHRGAEFMPILREWVDAGKLTVRLNETVGLENVLEGYERMLSGKAIGKVIVKVGD.... 336
186  5.000e-48 18  Bacillus cereus ZK gi|52142155||ref|YP_084674.1| quinone oxidoreductase (NADPH:quinone reductase) [ protmod 7 ..............HSFGDSSVFQLEEVA-KPKLLPGHVLIHVKATSVNPIDTKMRSG-AVSSVAPEFPAILHGDVAGIVIEVGEGVSKFKTGDEVYGCAGGFAEFMLADARLIAHKPKNVTMEEAA----ALPLVAITAWESLFDRANMKSGQNV--LIHGATGGVGHVAIQLAKWAGAK--VFTTASQQNKMEIAHRLGADIAINYKEESVQEYVQKHTNGGFEVIFDTVGGKNLDNSFEAAAVNGTVVTIAARSTHD----LSPLHAKGLSLHVTFMALK---ILHTDKRNDCGEILTKITQIVEEGKLRPLLDKSFTFDEVAQAHEYLESNKAIGKIVLK....... 328
187  5.000e-48 19  Bacillus cereus ZK gi|52143317||ref|YP_083512.1| quinone oxidoreductase [Bacillus cereus ZK] gi|519 protmod 9 ................FGGPEVMKYTDVDI-PAISEDQVLIRVVATSANFADIKSRYGKKGNKALPFIPG---IDAAGIVERVGSHVKNIYPGQRVIAFNGSYAEYVVANENLTFALPDEVDFQTAA----ACPIVSFTSYNLLANVARLQQG--ESVLIHAAAGGIGTTAIQLAKLLGAGTVIGTVGS-EAKKEIALDAGADYVIGHQDEDFVEKVNELTNGGVDVILDSISGTVSERSLKCLAYYGRLIHFGNASGEIGNFQTKDLHASCRSILGFSFGTTRK-----KRPELLQKTANEVFRYLRDGRLQIKATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
188  5.000e-48 21  Xenopus laevis gi|47507239||gb|AAH71035.1| LOC432094 protein [Xenopus laevis] protmod 77 ............................APVPVPGDGELLVRNRFVGINASDINYSSGRYDISTKPPFDAGF----EGIGEVVASASKTYAVGQTVAYVQGGFAEYTVIPAQLAVPVP------LVKPEFLTLLISGTTAYISLKEMGQLSEGKKV--LVTAAAGGTGQFAVQLAKKAKC--YVIGTCSSHKKAGFLKSIGCDLPINYKTENIGSVLKSQFPDGLDVVYESVGGEMFDLSVNCLATKGCLIIIGFISGYQTSQGILPVKAGALPAVLLKKSASIHGFFLNHYLSEYKEAIMSLLKLYQKGELVCEVDRFTGLESIFRAVDYMYTGKNIGKIVVEL...... 391
189  6.000e-48 22  Rattus norvegicus gi|34932585||ref|XP_214526.2| similar to hypothetical protein MGC45594 [Rattus n protmod 56 .............................PVPLPGDGDLLVRNRFVGINASDINYSAGRYDPSVKPPFDIGF----EGIGEVVASASAKYTVGQAVAYVPGSFAEYTVVPASIAIPMP-SVKPEYLTLLVS-----GTTAYISLKELGELSEGKKV--LVTAAAGGTGQFAVQLSKLAKC--HVVGTCSSDEKSAFLKSVGCDRPINYRTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPVKAGALPAKLLKKSASLRGFFLNHYFDKYQAAMEHLLQLYTRGDLVCEVDRFIGLESIFQAVDYMYSGKNIGKLVVEL...... 369
190  6.000e-48 20  Enterococcus faecalis V583 gi|29374762||ref|NP_813914.1| oxidoreductase, zinc-binding [Enterococcus faecali protmod 14 ......................LAIEEVPL-PTIHDNDVLVKIIAASINPIDLKTKDGKVKMDYQMPLILGSDF--AGIVVSVGKNVQNFRLGDAVYGRVGTFAEYIAVDQAAVAMKPKNLTFEEAA----AIPLVGLTSYQALHDIMNVQPGQKV--LIQAGSGGIGTIAIQLAKLAGA--YVATTTSSKNK-EWVQALGADEVIDYRTQNFEEVLSD-----YDYVFDTMGGTILEKAFSVVKPQGKVVTLSGIPNERFAKEYGLPLWKQWAFKIATRKIATDVSYHFLFMRPDGEQLALLTEFIEQGKLQPIIDRVVPFSQIQEAVDYSLTGRAQGKIVVKIAE.... 333
191  7.000e-48 24  Leishmania amazonensis gi|1055339||gb|AAA81326.1| cP36 protmod 25 ........................VVEAHLPEEVPEGMVRVSVKYAGVNASDLNFTNGSYFKNVQPPFDCG--FEAAGTVVQIGAGVANVKVGDHVVLMYGCFAEFLDAPAERCIPVP------ELKPEYSVLPVSALTAAVALGEVGRVKKGD--VALVTAAGGGTGQIAVQLFKHVYGCTVIGT-CSSEEKAEFLKSIGCDHVINYKTESLDGRLHELCPKGVDVVYECVGGHTFNDAVRHVAVHGRVVIIGSISSYKSGVPFSDPSGTSVTMLLLVKSASLNGFFLPQFHDVIPKYMANLLQYLKAGKLFVDKKVFHGLSSVADAVDHLYSGANYGKVLVEI...... 339
192  7.000e-48 17  Arabidopsis thaliana gi|21593811||gb|AAM65778.1| putative NADPH quinone oxidoreductase [Arabidopsis t protmod 11 ..................KPEVLQLRDVADPE-VKDDEVLIRVLATALNRADTLQRLGLYNPP--PGSSPYLGLECSGTIESVGKGVSRWKVGDQVCALLGGYAEKVSVPAGQIFPIPAGISLKDAAAF----PEVACTVWSTVFMMGRLSVG--ESFLIHGGSSGIGTFAIQIAKHLGV-RVFVTAGSDEKL-AACKELGADVCINYKTEDFVAKVKAETDGGVDVILDCIGAPYLQKNLDSLNFDGRLCIIGLMGGANAEIKLSSLLPKRLTVLGAALRPRSPE----NKAVVVREVEKNVWPAIEAGKVKPVIYKYLPLSQAAEGHSLMESSNHIGKILL........ 323
193  9.000e-48 17  Bacillus cereus ATCC 14579 gi|30021600||ref|NP_833231.1| Quinone oxidoreductase [Bacillus cereus ATCC 14579 protmod 11 ......................MRMAEVPTPE-INEYEVLAEIHAASINPIDFKIRDGKVKMLYEMPLILGNDF--AGVITKVGSKVTRFKVGDEIYARPGTFAEYIAIHEDDIALKPKNLSFEEAA----SIPLVGLTSYQALHDIMQLQKG--QKILIHAGSGGVGTFAIQLAKIMGA---IVTTTASEAGANLVTSLGADEIINYKTEKFEDILKN-----YDAVFDTIGGATLEKSFNIIKRGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTHNAQYSFLFMKPSGDQLRTIANYIEAGEIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKI...... 328
194  1.000e-47 20  Bacillus cereus ATCC 14579 gi|30021484||ref|NP_833115.1| Quinone oxidoreductase [Bacillus cereus ATCC 14579 protmod 7 ..............HSFGGSSVFQLEEVS-KPKLLPGHVLIDVKATSVNPIDTKMRSG--AVSAVAP-EFPAILHGDVAGIVVGEGVSKFKCGDEVYGCAGGFAEFMLADARLIAHKPKSLTMEAAA----ALPLVAITAWESLFDRANIKSGQNV--LIHGATGGVGHVAIQLAKWAGAK--VFTTASQQNKMEIAHRLGADIAINYKEESVQEYVQKHTNGGFEVIFDTVGGKNLDNSFEAAAVNGTVVTIAARSTHD----LSPLHAKGLSLHVTFMALK---ILHTDKRDACREILTKLTQIVEEGHLRPLLDKTFTFDEVAQAHEYLESNKAIGKIVLK....... 328
195  1.000e-47 17  Ralstonia metallidurans CH34 gi|48770881||ref|ZP_00275224.1| COG0604: NADPH:quinone reductase and related Zn- protmod 8 .............EYGAP--EVLQ-ETQRPDPEPKAGEILIRVAAAGINRPDVFQRTG----NYPVPPGASDLPGLEVAGVVVGGDLSGLKAGDRVCALVGGYAELCTAPIEQCLPVPEGLTDIEAA----ALPETFFTVWSNVFDRGQLGKGPRETLLIQGGSSGIGTTAIQIAKALGFK--VFVTAGSDDKCKACESLGADRAINYKTQDFVAEVKALTEGGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASFKGAIAQALHQNVW----PLLASGKIKPVIHKVFPAAQAADAHRLMESSEHIGKIVLT....... 333
196  1.000e-47 24  Leishmania amazonensis gi|308883||gb|AAA73554.1| zeta-crystallin NADPH-oxidoreductase gi|1172800|sp|P42 protmod 25 ........................VVEAHLPEEVPEGMVRVSVKYAGVNASDLNFTNGSYFKNVQPPFDCG--FEAAGTVVQIGAGVANVKVGDHVVLMYGCFAEFLDAPAERCIPVP------ELKPEYSVLPVSALTAAVALGEVGRVKKGD--VALVTAAAGGTGQIAVQLLKHVYGCTVIGT-CSSEEKAEFLKSIGCDHVINYKTESLDGRLHELCPKGVDVVYECVGGHTFNDAVRHVAVHARVVIIGSISSYKSGVPFSDPSGTSVTMLLLVKSASLNGFFLPQFHDVIPKYMANLLQYLKAGKLFVDKKVFHGLSSVADAVDHLYSGANYGKVLVEI...... 339
197  1.000e-47 16  Agrobacterium tumefaciens str. C58 gi|15155807||gb|AAK86631.1| AGR_C_1508p [Agrobacterium tumefaciens str. C58] gi| protmod 41 ............................APLPKPARGEILVKVEAAGVNRPDVAQRQGI----YPPPKGASPILGLEIAGEVVGEGVDEFKLGDKVCALGGGYAEYCAVPAGQALPFPKGYDAVKAA----ALPETFFTVWANLFQMAGLTEG--ETVLIHGGTSGIGTTAIQLAKAFGA-EVYATAGSAEKCEACVK-LGTKRAINYREEDFAEIVKSETGGGVDVVLDMIGAAYFEKNLAALAKDGCLSIIAFLGGATAEKVDLRPI---MVKRLTVTGSTMRPRTADEKRAIRDELVEQVWPLIESGKVAPVINRVFTLEEVVDAHRLMESSNHIGKIVMKVS..... 348
198  1.000e-47 18  Bacillus cereus G9241 gi|47566883||ref|ZP_00237601.1| quinone oxidoreductase [Bacillus cereus G9241] g protmod 9 ................FGGPEVMQYTDVDI-PAISKDQVLIRVVATSVNFADIKSRYGKKGNKALPFIPGIDV---AGIVECVGSHVKNIHPGQRVIAFNGSYAEYVVANENLTFVLPDEVDFQTAA----ACPIVSFTSYNLLANVARLQQG--ESVLIHAAAGGIGTTAIQLAKLLGAGKVIGTVGS-EGKKEIALDAGADYVFCHQDEDFVEKVNELTYGGVNIILDSISGSVSERSLKCLAYYGRLVHFGNASGEIGNFHTKDLHASCRSILGFSFGTTRK-----KRPELLQETANEVFRYLRDGRLQIKATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
199  1.000e-47 21  Anabaena variabilis ATCC 29413 gi|53765140||ref|ZP_00161353.2| COG0604: NADPH:quinone reductase and related Zn- protmod 327 ..............TAFGDAEKFEIQTVPI-PTLKANQVLVRVCATSINPVDYQTRRGDYKELVQLPAILGVDVS--GVIEAIGEAVTDFKVGDNVFGEFGSYAQYHVADAAIVALKPANLSHIEAASFPLAGG----TAWDCLVTRGNLQVG--ETVLIHAGAGGVGSIAVQLAKAIGAY-VFATCSSRNR--DFVTELGADRVIDYKNEDYVEVIRQETNGGVDLVLDTIGGETIQRSLEIIRPFGRLTSIVDIAI------------PQSLLEAWGKNLTIHFVFSPQYRAK----LEALTKLIERHQLRPVIDSVFSWDQVVLAHQRLEQGGTRGKIVLKFTED... 639
200  1.000e-47 20  Bacillus cereus G9241 gi|47564523||ref|ZP_00235568.1| alcohol dehydrogenase, zinc-containing [Bacillus protmod 7 ..............HSFGDSSVFQLEEVS-KPKLLPGHVLIHVKATSVNPIDTKMRSG--AVSAVAP-EFPAILHGDVAGIVVGEGVSKFKSGDEVYGCAGGFAEFMLADARLIAHKPNNLTMEEAA----ALPLVAITAWESLFDRANIKPGQNV--LIHGATGGVGHVAIQLAKWAGAK--VFTTASQQSKMEISHHLGADIAINYKEESVQEYVQKHTNGGFEVIFDTVGGKNLDHSFEAAAVNGTVVTIAARSTHDLSPLHTKGLTLHVTFMALK-------ILHTDKRNHCGEILTKITQIIEEGKLRPLLDSKFTFDEVAQAHEYLESNKAIGKIVLK....... 328
201  2.000e-47 19  Yersinia pestis biovar Medievalis str. 91001 gi|45441595||ref|NP_993134.1| probable Zinc-binding dehydrogenase [Yersinia pest protmod 43 .............................PTPMPAAGEILVKVSAAGVNRPDVMQRRG----QYAPPPGASDIPGLEVAGEVVAADVTRFKIGDNVCGLIGGYAQYCVIHETNALPIPQGLSAIEAA----ALPETFFTVWTNLFQRGHFTAG--ETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQACLN-LGADIAINYHTQDFVAETKRATAGGADVIVDLIAGDYVARNYDAAAMNGRIVQIGTQNGHAKDLNLMLMLIKRLTHT----GSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFSTFPLEAAAKAHELMESSTHIGKIVLT....... 347
202  2.000e-47 20  Tetraodon nigroviridis gi|47210993||emb|CAF93013.1| unnamed protein product [Tetraodon nigroviridis] protmod 82 ..............................VPTPGDAELLVRNRFVGINASDINYSAGRYDRTLKPPFDAGF----EGIGEVVGSASSRYTVGDAVAYFSGAFAEYTVVPAKVCVPVPA-VRPEFLTLLVS-----GATAFIALKRLGDLTKG--ETVLVTAAAGGTGQFAVQFAKQAGC--HVIGTCSSDEKAGFLKSLGCDRPINYASEDLARTLRTEYPRGVDVVYESVGGSVLEAAVNNLANKGRVIVIGFISGYQSASGIPRFRGETLPVKLLQKSASLRGFFLPHFSGDYRDALSSMTHMLSRGQLVCEVDSFTGLESVFRAVDHMYAGKNLGKVVVDLAPP... 397
203  2.000e-47 17  Bacillus anthracis str. `Ames Ancestor` gi|47528850||ref|YP_020199.1| alcohol dehydrogenase, zinc-containing [Bacillus a protmod 14 ......................MRMAEVPIPE-INEHEVLAEIHAASINPIDFKIRDGKVKMLYEMPLILGNDFAGVII--KVGSKVTRFKIGDEIYARPGTFAEYIAIHEDDIALKPKNLSFEEAA----SIPLVGLTSYQALHDIMQLQ--KDQKILIHAGSGGVGTFAIQLAKIMGAT---VTTTASEAGPDLVKSLGADQIINYKTEKFEEILKD-----YDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFSKEFGSGFFKTFLFSLASKKLTHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKM...... 331
204  2.000e-47 17  Bacillus cereus G9241 gi|47564631||ref|ZP_00235676.1| oxidoreductase, zinc-binding [Bacillus cereus G9 protmod 14 ......................MRMAEVPTPE-INEYEVLAEIHAASINPIDFKIRDGKVKMLYEMPLILGNDFS--GVITKVGSKVTRFKVGDEIYARPGTFAEYIAIHEDDIALKPKNLSFEEAA----SIPLVGLTSYQALHDIMQLQKG--QKILIHAGSGGVGTFAIQLAKIMGAT---VTTTASEAGANLVKSLGADEIINYKTEKFEDILKD-----YDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTHNAQYSFLFMKPSGDQLRTIANYIESGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKM...... 331
205  2.000e-47 20  Bacillus anthracis str. `Ames Ancestor` gi|47527407||ref|YP_018756.1| quinone oxidoreductase [Bacillus anthracis str. `A protmod 9 ................FGGSEVMKYTDVDI-PAISEDQVLIRVVATSVNFADIKSRYGKKG-NKALPFILG--IDAAGIVERVGSHVKNIYPGQRVIAFNGSYAEYVVANENLTFVLPDEVDFQTAA----ACPIVSFTSYNLLANVARLQQG--ESVLIHAAAGGIGTTAIQLAKLLGAGTVIGTVGS-EAKKEIALDAGADYVIGHQDEDFVEKVNELTNGGVDVILDSISGTVSERSLKCLAYYGRLIHFGNASGEIGNFQTKDLHASCRSILGFSFGTTRK-----KRPELLQETANEVFRYLRDGHLQIKATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
206  2.000e-47 19  Bacillus cereus ATCC 14579 gi|30020244||ref|NP_831875.1| Quinone oxidoreductase [Bacillus cereus ATCC 14579 protmod 9 ................FGGPEVMKYTDFDI-PAISEDQVLIRVVATSVNFADIKSRYGKKG-NKALPFILG--IDATGIVERVGSHVKNIHPGQRVIAFNGSYAEYVVANENLTFVLPHEVDFQTAA----ACPIVSFTSYNLLANVARLQQG--ESVLIHAAAGGIGTTAIQLAKLLEAGTVIGTVGS-EAKKEIALDAGADYVICHQDEDFVEKVNELTNGGVDVILDSISGTVSERSLNCLAYYGRLVHFGNASGEIGNFQTKDLHASCRSILGFSFGTTRK-----KRPELLQETANEVFRYLRDGRLQIKATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
207  2.000e-47 20  Tetraodon nigroviridis gi|47224021||emb|CAG12850.1| unnamed protein product [Tetraodon nigroviridis] protmod 82 ..............................VPTPGDAELLVRNRFVGINASDINYSAGRYDRTLKPPFDAGF----EGIGEVVGSASSRYTVGDAVAYFSGAFAEYTVVPAKVCVPVPA-VRPEFLTLLVS-----GATAFIALKRLGDLTKG--ETVLVTAAAGGTGQFAVQFAKQAGC--HVIGTCSSDEKAGFLKSLGCDRPINYASEDLARTLRTEYPRGVDVVYESVGGSVLEAAVNNLANKGRVIVIGFISGYQSASGIPRFRGETLPVKLLQKSASLRGFFLPHFSGDYRDALSSMTHMLSRGQLVCEVDSFTGLESVFRAVDHMYAGKNLGKVVVDLAPP... 397
208  3.000e-47 18  Bacillus anthracis str. `Ames Ancestor` gi|47528724||ref|YP_020073.1| alcohol dehydrogenase, zinc-containing [Bacillus a protmod 7 ..............HSFGDSSVFQLEEVS-KPKLLPGHVLIDVKATSVNPIDTKMRSG--AVSAVAP-EFPAILHGDVAGIVVGEGVSKFKCGDEVYGCAGGFAEFMLADARLIAHKPNNITMEEAA----ALPLVAITAWESLFDRANIKSGQNV--LIHGATGGVGHVAIQLAKWAGA--NVFTTASQQNKMEIAHRLGADVAINYKEESVQYVQKHTNGNGFEVIFDTVGGKNLDNSFEAAAVNGTVVTIAARSTHD----LSPLHAKGLSLHVTFMALK---ILHTDKRNDCGEILTKITKIVEEGKLRPLLDKSFTFDEVAQAHEYLESNKAIGKIVLK....... 332
209  3.000e-47 20  Mus musculus gi|31559926||ref|NP_666202.2| zinc binding alcohol dehydrogenase, domain contain protmod 56 .............................PVPLPGDGDLLVRNRFVGINASDINYSAGRYDPSLKPPFDIGF----EGIGEVVASASARYTVGQAVAYMPGSFAEYTVVPASIAIPMP-SVKPEYLTMLVS-----GTTAYLSLEELGELSEGKKV--LVTAAAGGTGQFAVQLSKIAKC--HVIGTCSSDEKAAFLKSIGCDRPINYRTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPIKAGVLPTKLLKKSASLRGFFLNHYFSKYQAAMERLLELYARGDLVCEVDRFIGLESVFQAVDYMYTGKNTGKLVVEL...... 369
210  3.000e-47 21  Homo sapiens gi|28557745||ref|NP_787103.1| zinc binding alcohol dehydrogenase, domain contain protmod 56 .............................PVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGF----EGIGEVVASASARYTVGQAVAYMPGSFAEYTVVPASIATPVP-SVKPEYLTLLVS-----GTTAYISLKELGGLSEGKKV--LVTAAAGGTGQFAMQLSKKAKC--HVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDRFTGLESIFRAVNYMYMGKNTGKIVVELPHS... 372
211  4.000e-47 20  Bacillus anthracis str. A2012 gi|21399983||ref|NP_655968.1| adh_zinc, Zinc-binding dehydrogenases [Bacillus an protmod 9 ................FGGSEVMXYTDVDI-PAISEDQVLIRVVATSVNFADIKSRYGKKG-NKALPFILG--IDAAGIVERVGSHVKNIYPGQRVIAFNGSYAEYVVANENLTFVLPDEVDFQTAA----ACPIVSFTSYNLLANVARLQQG--ESVLIHAAAGGIGTTAIQLAKLLGAGTVIGTVGS-EAKKEIALDAGADYVIGHQDEDFVEKVNELTNGGVDVILDSISGTVSERSLKCLAYYGRLIHFGNASGEIGNFQTKDLHASCRSILGFSFGTTRK-----KRPELLQETANEVFRYLRDGHLQIKATKSFPLQDAGKAHEWVESRKSTGKVILTVQSSS.. 328
212  4.000e-47 17  Burkholderia cepacia R18194 gi|46317541||ref|ZP_00218119.1| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................GPDVL-VPTTRPVPSPRHDEVLIRIHAAGVNGPDVFQRKGL----YDPPPGASDIPGLEVAGEVVAVGVTRFALGDEVCALIGGYAEYAVANESNTLAIPDGLDMTEAA----AMPETFMTVWLNLFQRGRFAAGDSV--LIHGGASGIGTTATMLAKAFGASTIITTVGSEAQRDASLR-LGADLAIEYRNEDFVDAVKRFTDGGVDVIVDIIAGDYVARNFAAAAMNGRIVQIGVINGPAKELDLFPMLTKRLTHI----GSTLRSRTYEEKAQLIRELEEAVWPLIRQGTVKPQVYRTFDLRDASGAHALMDSGRHIGKIVLR....... 325
213  4.000e-47 33  Arabidopsis thaliana gi|9755699||emb|CAC01711.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 6 ..NKQVILKD--YVSGFPTESNFDFTTVELRVPEGTNSVLVKNLYLSCDPYMRICMGKPNPSTAAL------------------------------AQAYTPGQCYHLTHE----HFKIQHTDVPLSYYTGLLGMPGMTAYVGFYEICSPKKG--ETVYVSAASGAVGQLVGQFAKMMGCY-VVGSAGSKEKVDLLKTKFGFDYAFNYKEEDLSAALKRCFPNGIDIYFENVGGKMLDAVLMNMNMHGRIAVCGMISQYNLENQEGVHNLSNI----IYKRIRIQGFVVSDFYDEYSKFLEFLHPHIKEGKITYVEDVADGLEKGPEALVGLFHGKNVGKQVVVIARE... 311
214  4.000e-47 19  Yersinia pestis CO92 gi|16121920||ref|NP_405233.1| probable Zinc-binding dehydrogenase [Yersinia pest protmod 31 .............................PTPMPAAGEILVKVSAAGVNRPDVMQRRG----QYAPPPGASDIPGLEVAGEVVAADVTRFKIGDNVCGLIGGYAQYCVIHETNALPIPQGLSAIEAA----ALPETFFTVWTNLFQRGHFTAG--ETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQACLN-LGADIAINYHTQDFVAETKRATAGGADVIVDLIAGDYVARNYDAAAMNGRIVQIGTQNGHAKDLNLMLMLIKRLTHT----GSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFSTFPLEAAAKAHELMESSTHIGKIVLT....... 335
215  5.000e-47 20  Rhodopseudomonas palustris CGA009 gi|39933992||ref|NP_946268.1| putative NADPH quinone oxidoreductase [Rhodopseudo protmod 18 ..................GPEVL-LPETRDVPKPGPGEILVKVAAAGVNRPDVAQRSG----SYPPPPGASDLPGLEIAGEVVGDGASRHKLGDKVMSLVGGYAEYCIAQDAQAMKVPAAYSMIEA----GATPETLMTVWHNVFERGGLQPG--ETLLVHGGSSGIGTMAIQLAVALG-SKVITTVGSQDKADACLK-LGASRAINYKTEDFVAAVKEATGGGVEVILDMVGGDYIERNYDAAAMDGRIVQIAFLGGAKANVN----FVKLMTKRLHHTGSTLRPRSNADKAAMVAAIEAKVLPLLEQGRIKPLIDGTFALRDAADAHRRMETSQHIGKIVLTV...... 332
216  5.000e-47 17  Ralstonia eutropha JMP134 gi|46132515||ref|ZP_00202925.1| COG0604: NADPH:quinone reductase and related Zn- protmod 8 .............EYGAP--EVLQ-ETQRPDPVPGAGEILIRVAAAGVNRPDVFQRTGNYPVPPGASDLPGLEVAGVVVGGDLSHADNRFKVGDRVCALVGGYAQLCTAPVAQCLPAPKGLSDIEAA----ALPETFFTVWSNVFDRGYLGRGKDETLLIQGGSSGIGTTAIQIAKALG--YKVFVTAGTDEKCKACEDLGADRAINYKTQDFVAEVASLTEGGVDVILDMVAGSYLARELKCIADDGRIVIIALLGGAKAEIPLGDILRRRITVTGSTLRPRSASF----KGQIAQALHQQVWPLLEAGKIKPVIHKVFPAAQAAEAHRLMESSEHIGKIVLT....... 333
217  5.000e-47 18  Yersinia pseudotuberculosis IP 32953 gi|51596738||ref|YP_070929.1| probable Zinc-binding dehydrogenase [Yersinia pseu protmod 31 .............................PTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDIPGLEVAGEVVA--IAADVTRFKIGDNVCGLIGGYAQYCVIHETNALPIPQGLSAIEAA----ALPETFFTVWTNLFQRGHFTAG--ETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQACLN-LGADIAINYHTQDFVAETKRATAGGADVIVDLIAGDYVARNYDAAAMNGRIVQIGTQNGHAKDLNLMLMLIKRLTHT----GSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFSTFPLEAAAKAHELMESSTHIGKIVLT....... 335
218  7.000e-47 22  Streptomyces sp. JP95 gi|21039509||gb|AAM33674.1| putative NADPH:quinone oxidoreductase GrhO7 [Strepto protmod 2 ....RIV---RHYEHGAP--SVLRLEEVE-KPQPGPGQVLIRAEAIGVTFAEVQRRQGIPGHAGLPGAPGGDV---AGTVEALGEGVTGFAVGDRVVGDVDAYADYVVTGTDWLIKIPQDLD----AAAATLLPSPAQTAYHAIKEAGRLRPG--QSIVIDAASGGVGHLAVQIAKALGAGKVIATA-STQAKLDFARELGADVTVNYTDEDWTDQVLAATDGGADIVLETVGGDVLLKSLGITAQFGTLVFYGSASGDIPDLPT-LALSRMKNVAGFSLYA-----MLYNKQDAVAEGQRHLLDLIASGEVKPVVHDRLPLDEAVKAHELLEARAQLGKIVL........ 323
219  7.000e-47 19  Pseudomonas aeruginosa UCBPP-PA14 gi|53727511||ref|ZP_00138730.2| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................GPEVL-VATSRPLPTPGPREVLVEVRAAGVN----GPDVLQRKGVYDPPPGASDIPGLEIAGTVVGSEVSRFAVGEAVMALIGGYAQFAVADERTTLHLPDGLGMEEAA----ALPETFMTVWVNLFQRGGFKAG--ETLLVHGGASGIGTAATMLGKAFGAAK-IFTTISSEAQREASLRLGADLAINYTEQDFVEEVLRGTEGGVDVIVDIVAGDYVTRNYQAAAMNGRIVQIGVIKGKAAEV----DLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGTVRPQVFRTFPLEQARQAHELMDSGQHIGKIVLTSAP.... 328
220  8.000e-47 33  Burkholderia cepacia R18194 gi|46311381||ref|ZP_00211988.1| COG2130: Putative NADP-dependent oxidoreductases protmod 13 ..NTLVHQVERP--HGEPRREHFRFVRQPLAP-LAPGEVLVRNVHFSVDPYMRECMDGD--------WALHAPLEGRTIGQVLRTTDPMLRPGDWVFHRQ-GWRTYAQVPAQAL-RVIRPVEGVPLTAWLSILGGTGLTAWVALTRIVRLQPG--ESLYVSAAAGGVGTAAGQFAKLLGANRIVGSTSHERKARQLTSGLGYTDAFVYQPGQVGAQLRERIPEGFDVYLDNVGGEQLEAAIAVLKDHGRAALIGAVAQYSA---LQPPAAPRNLFDVVGKSLTLQGFLVKDYANLQQELEAFAIPHLQRGDIVAPETITKGFDTIVDAFLAMLAGGNLGKAIVSVDTDDA. 342
221  8.000e-47 20  Pseudomonas putida KT2440 gi|26986817||ref|NP_742242.1| quinone oxidoreductase [Pseudomonas putida KT2440] protmod 1 .MAKRIQF----SQHGGP--EVLQFVEFE-PTPPGPQQVRVRNHAIGLNFIDTYFRSGLYAPPSLPS---GLGTEAAGVVEAVGEGVSRLKVGDRVAGPLGAYSEVHTLPEANLVKLPDTISFEQAA----AVMLKGLTVQYLLKQTYEVKAGD--VILFHAAAGGVGSLACQWAKALGA-KLIGTVSSAEKA-ERAKALGAWATIDYSREDVAKRVLELTDGKCPVVYDGVGADTWLTSLDCLRPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATY-----ANNAENTQAMADDLFAMIGSGKLAVDIQQRYPLSEAAKAQAELSARRTVGSTVL........ 323
222  9.000e-47 19  Pseudomonas aeruginosa PAO1 gi|9947057||gb|AAG04526.1| probable oxidoreductase [Pseudomonas aeruginosa PAO1] protmod 11 ..................GPEVL-VATSRPLPTPGPREVLVEVRAAGVN----GPDVLQRKGVYDPPPGASDIPGLEIAGTVVGSEVSRFAVGEAVMALIGGYAQFAVADERTTLHLPDGLGMEEAA----ALPETFMTVWVNLFQRGGFKAG--ETLLVHGGASGIGTAATMLGKAFGAAK-IFTTISSEAQREASLRLGADVAIDYTEQDFVEEVLRGTEGGVDVIVDIVAGDYVTRNYQAAAMNGRIVQIGVIKGKAAEV----DLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGTVRPQVFRTFPLEQARQAHELMDSGQHIGKIVLTSAP.... 328
223  1.000e-46 16  Agrobacterium tumefaciens str. C58 gi|17934733||ref|NP_531523.1| quinone oxidoreductase [Agrobacterium tumefaciens protmod 20 ............................APLPKPARGEILVKVEAAGVNRPDVAQRQGI----YPPPKGASPILGLEIAGEVVGEGVDEFKLGDKVCALGGGYAEYCAVPAGQALPFPKGYDAVKAA----ALPETFFTVWANLFQMAGLTEG--ETVLIHGGTSGIGTTAIQLAKAFGA-EVYATAGSAEKCEACVK-LGTKRAINYREEDFAEIVKSETGGGVDVVLDMIGAAYFEKNLAALAKDGCLSIIAFLGGATAEKVDLRPI---MVKRLTVTGSTMRPRTADEKRAIRDELVEQVWPLIESGKVAPVINRVFTLEEVVDAHRLMESSNHIGKIVMKVS..... 327
224  1.000e-46 19  Ralstonia solanacearum gi|17429203||emb|CAD15891.1| PROBABLE NADPH:QUINONE REDUCTASE, ZETA-CRYSTALLIN H protmod 4 ........AIRIFETGGP--EVMQLVD-AEAPAPGPGEARIRQHAIGLNYIDVYFRSGL----YPQPLPGGIGMEASGVVEAVGEGVTHVRPGDRVAYATGAYAEVRTMPADILVRLPEAIGFETGA----AMMLQGLTAQYLLRDSYRVQPGD--TVLFHAAAGGVGLIACQWLKALGAT-VIGTVGS-DAKAALARAHGCDHTIVYTRENFTERVREITGGGVPVVYDGIGKDTFSGSLDCLAPRGMMVSYGNASG-----PVPPFDLGVLSAKGSLKLTRPTLMTYTAQRALLEPMAAELFDVVGSGKVKIEIHQRYALADAAQAHRDLEARKTTGSTIL........ 322
225  1.000e-46 16  Bordetella bronchiseptica RB50 gi|33600163||ref|NP_887723.1| putative alcohol dehydrogenase [Bordetella bronchi protmod 7 ............YEHGGPGS--IKYETAFPDPVAKPDEVILKVGAATLNYHDVFTRNGMPGITVPMPIIMGLDFAGEVV--EVGADVKDWKVGDRVLARHGGLAEYCAVPDHHLVRLPDDVSFETAA----CLPVAYGTAWRMMQTIGKIQSG--ERVLILGASGGVGTCCVQLAKMAGAE--VVAAASSPEKLARLTELGADHVIDYKQEDFMKAHRRLYENGVDVVVNFTGGDTWVKSLRTLHRNGRVLTCGATAGYDPKEDLRFIWSYELQILGSNGWTRDELIAL--------------LEQVRAGKLQPIIDRTYGLADINDAFRQLEDRQVFGKILVK....... 335
226  2.000e-46 15  Zymomonas mobilis gi|4378174||gb|AAD19419.1| unknown [Zymomonas mobilis] gi|56544242|gb|AAV90396.1 protmod 1 .MMKEVIIKE------AGSADVLALHD-APIPTPKADEILVKIAAAGINRPDIIQRMGQYPLPPDATPIPGLEISGTVIA--LGQDVEEFKIGDRICGLTGGYAEYGVIPAKQALPVPDNLSLTEAA----AIPETYFTVWANLFDIGQAKSG--ETVLVHGGSSGIGSAAIILAKACGLK--VFTTVGNQEKAAAVEKLGA-IAINYNEQDFLTIIQEEMAGGVDVILDIIGGSYFSRNMKALAFGGRLVIVGAMGGRIADKFD---LLPLIFKRATISGSTMRARTADEKANIARSLREKVWPLLEQGQCHPLIDSSFPLEKVQDAHKRMESRDHCGKIVLTMPE.... 328
227  2.000e-46 27  Magnaporthe grisea 70-15 gi|38105721||gb|EAA52112.1| hypothetical protein MG03707.4 [Magnaporthe grisea 7 protmod 10 ...KQWILTNKPA--GEPILSTWQLKEVPL-PPLEPGQILAKVKYFSNDTGLRNFIQSTVAADYVPTVPLGSPMRSGVIAEVVESASDKFKAGDMVMDFHLGWGEHCILNADESQPLGPLPGGLSPTHYLGALGASGLAAYTGLYYAGKAKPG--QTIVISAAAGATGTMAVQIAKILGAGKVIGIS-SSEEKCKFVKSLGAHECLNYNSPTFKEDLIKATPDEVDLFFDNTGGEILDLMLTRVKKHGHVAVCGAVTMYNNEEPLKLKNWFEV----ISCRITIRGFIMLDYMDKVPAIMGELMGAIADGRLQLGDAETISIEEQPKVWMRLFNGEDQGKLITRLN..... 357
228  2.000e-46 17  Bacillus cereus ZK gi|52142023||ref|YP_084807.1| alcohol dehydrogenase, zinc-containing [Bacillus c protmod 14 ......................MRMAEVPIPE-INEHEVLAEIYAASINPIDFKIRDGKVKMLYEMPLILGNDFAGVII--KVGSKVTRFKVGDEIYARPGTFAEYIAIHEDDIALKPKNLSFEEAA----SIPLVGLTSYQALHDIMQLQ--KDQKILIHAGSGGVGTFAIQLAKIMGAT---VTTTASEAGSDLVKSLGADQIINYKTEKFEEILKD-----YDAVFDTIGGTTLEKSFDIIKSGGSIVSVSGMPNARFGKEFGSGFFKTFLFSLASKKLTHNAQYSFLFMKPSGDQLRIIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKM...... 331
229  2.000e-46 14  Aquifex aeolicus VF5 gi|15606558||ref|NP_213938.1| alcohol dehydrogenase [Aquifex aeolicus VF5] gi|29 protmod 7 ..............TGFGGIENLKYVEDFPKPEPKEDEVLIRVKAVALNHLDIWVRMGALPVKPELPHILGSDVS--GVVEKVGSLVKNVKEGEEVIIAPGGYAEYVAVPARNVIKKPKNLSFEEAASY----PLTFLTVWNALVDKAQIKPYSRV--FIWAGSSGVGVAGIQLAKAFNA--FVITTAGNEEKAKKCKELGADLVFNHYKDDVVKKVREVFKEGVDVVVDHIGEATFWKSVQMLRKGGKLVFFGTTTGSKGEIDIRYVFVREIQLLGVYMGSRANLF--------------KITELFERGVFKPVVDKVFPLKEVPQAHKYLEESKHFGKVVLKV...... 342
230  3.000e-46 20  Chloroflexus aurantiacus gi|53797071||ref|ZP_00357945.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 ......MRAIQIHQTGGP--EQLQMVDIPLPEP-APGQVRIKVAAAGVNFI------DIYHRTGLYPQPLPFTLGLEVAGTIVGEGVSEWAVGDRVTTASGGYAEYALAAADKLVRVPDNVDLETAAAVL----LQGMTAHYLTFSTFPLKAGDTC--LVHAAAGGVGLLLIQIARRLGA-RVIGTV-STDEKAELARAAGADEVVIYTRESFVERVRAFTNGGVDVVYDSVGASTLEGSLDSLRPRGMFVTFGNASGPLPPISPLLLSSKGSLFMT-----RPTLFHYIATPEELRWRASDLFTWIGAGELQVRIHRRYPLSEAAEAQIALASRATTGKLLL........ 320
231  3.000e-46 28  Candida albicans SC5314 gi|46437142||gb|EAK96494.1| hypothetical protein CaO19.10651 [Candida albicans S protmod 6 .VATQVFLKTCPSGFIHTKDSTFEVKEVPVPE-LKEGQVLAKVLYLSNDPTQRTWLRGDNSPSYMPPVHEGTPMASLGLAEIIESKSEKYQKGDIASGRIY-WADYAVVPDVVFFNKIDKSLGLPLEFFLSILGMTTLTAFFGLTEVGKLKKEKGPVVCVSAASGATGSSVVQIAKHLGASKVIGISGSDE-KCKWVESLGADLCVNYKNSEWVSDYLAKDNEGIDVYFDCVGGEILSFILTKMNKFGHVAACGAISGYNDNKAFAVTSWPFI----ITNSLNVQGFIVGNFAAQFPEAIKILGAAVKEGKIKVQDEPSKRLADIPRIWMLFEDNKPNGKLLIKVD..... 372
232  3.000e-46 19  Brucella suis 1330 gi|23348598||gb|AAN30637.1| alcohol dehydrogenase, zinc-containing [Brucella sui protmod 22 ..............................VPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDIVA--LGHGVKRFRKGDQVVALLGGYAEYAVVHESNALPLPSGFGYIEAA----AIPETFFTVWHNVFERGGLKEG--EVFLVHGGSSGIGTTAIQLAKAFGAT--VITTAGSKEKCDACVKLGADRAINYHEEDFVAVVKEMTGGGVDVILDMVGGDYVERNYKAAAEDGRIVQIAFLNGAKAT---------ANFAILMTKRLTHTGSTLRPRPVAFKAGIAKVWPLLAQRRVAPVMDMIFSLKDAWRAHERMEEGRHIGKIVLDIA..... 326
233  3.000e-46 19  Brucella melitensis 16M gi|17986585||ref|NP_539219.1| QUINONE OXIDOREDUCTASE [Brucella melitensis 16M] g protmod 32 ..............................VPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDIVA--LGHGVKRFRKGDQVVALLGGYAEYAVVHESNALPLPSGFGYIEAA----AIPETFFTVWHNVFERGGLKEG--EVFLVHGGSSGIGTTAIQLAKAFGAT--VITTAGSKEKCDACVKLGADRAINYHEEDFVAVVKEMTGGGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKAT---------ANFAILMTKRLTHTGSTLRPRPVAFKAGIAKVWPLLAQRRVAPVMDMIFSLKDAWRAHERMEEGRHIGKIVLDIA..... 336
234  3.000e-46 19  Thermobifida fusca gi|48835162||ref|ZP_00292163.1| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ....RAIVVSAPG-----GPENLVWQEVPD-PQPGPGEVLVEVAATAVNRGDISQREGNYPPPPGAPEYLGLECSGRIIAFGPGTEDSGYRVGDEVCALLGGYAERVAVPVGQLLPVPKGVGLVEAA----ALPEVACTVWANVFMTAQLREG--EALLVHGGASGIGTFAIQAARAFGA--RVLTTAGSEAKLARCRELGADVAINYRSEDFAARVREETGGGVDVVLDIMGGSYLEANLRSLAVGGRLVVIGLMGGRRAELDLGRMLIKRLSVHA----ATLRSRPLEEKAAIVAQVTERVWPLVERGEIRPVVDRVLPLSQAAEAHRVLEASEHVGKILL........ 325
235  4.000e-46 17  Bacillus cereus ATCC 10987 gi|42782572||ref|NP_979819.1| alcohol dehydrogenase, zinc-containing [Bacillus c protmod 17 ..........................TEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLYEMPLILGNDFS--GVITKVGSKVTRFKVGDEIYARPGTFAEYIAIHEDDIALKPKNLSFEEAA----SIPLVGLTSYQALHDIMHLQKG--QKILIHAGSGGVGTFAIQLAKIMGAT---VTTTASEAGTNLVKSLGADEIINYKTEKF-----EEILTNYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGTPNARFGKEFGSGFFKTLLFSLASKKLTHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFSFEDAQKAMEYSEAGRAKGKIIVKI...... 331
236  4.000e-46 18  Neurospora crassa gi|28949991||emb|CAD70876.1| probable NADPH quinone oxidoreductase homolog PIG3 protmod 12 .............KNGKGSADNLFINPDTPLPQAQPGQALVKVKAFGLNRMDLIQREGHYPLPPQAPSTLGVEFSGTIESFGDG-DHGDFNVGDEVFGLGGAYAEYIAVSSKMLLHKPAHLSFEQAAG----VPETWITATQALHFVLGGIGEQGKTILWHAGASGVSIAGIQLSKLAGAKQIFATAGSADKCKFIENELGATAAFNYKEQDWVEEIMKKTDGGVDLVVDFIGASYFQKNLDVVARDGRICMLGLMGGAVAD--------KVDISKLLYKRARVEGSTLRNYQGQLRDKLSEYLPKFESGELKIFIDTVLPFEEIVKAHKQLEANTTMGKIICTVS..... 338
237  4.000e-46 28  Candida albicans SC5314 gi|46437070||gb|EAK96423.1| hypothetical protein CaO19.3139 [Candida albicans SC protmod 6 .VATQVFLKTCPSGFIHTKDSTFEVKEVPVPE-LKEGQVLAKVLYLSNDPTQRTWLRGDNSPSYMPPVHEGTPMASLGLAEIIESKSEKYQKGDIASGRIY-WADYAVVPDVVFFNKIDKSLGLPLEFFLSILGMTTLTAFFGLTEVGKLKKEKGPVVCVSAASGATGSSVVQIAKHLGASKVIGISGSDE-KCKWVESLGADLCVNYKNSEWVSDYLAKDNEGIDVYFDCVGGEILSFILTKMNKFGHVAACGAISGYNDNKAFAVTSWPFI----ITNSLNVQGFIVGNFAAQFPEAIKILGAAVKEGKIKAQDEPSKRLADIPRIWMLFEDNKPNGKLLIKVD..... 372
238  4.000e-46 22  Mesorhizobium sp. BNC1 gi|45914623||ref|ZP_00196745.1| COG0604: NADPH:quinone reductase and related Zn- protmod 3 .....VVKAIRLRETGGP--EILRLEDYD-PGKPGPGEALIEQRAIGLNFI------DVYHRTGLYPTAKPFTPGSEAAGVVVGEGVEDLKPGDRVAYCVGAYAEQRLVRADRLVRVPDAVSDEQAASA----MLKGLTAWYLLRRTFPVKAGD--TILCHAAAGGVGLVLGQWAKHLGA-KVIGTAGSPEKV-ELAKAHGYDHVIDYTKEDFVAAVGELTSGGCDVVYDSVGKDTFPGSLDCLRPFGMFVSFGQSSG------VVPPFSINLLAQKGSLFATRPSFTYIAARKDLEEGAQELFSMIERGAVQVRVNQRYPLADVGRAHKDLEARRTTGMTVL........ 324
239  5.000e-46 19  Burkholderia fungorum LB400 gi|48784234||ref|ZP_00280600.1| COG0604: NADPH:quinone reductase and related Zn- protmod 19 .............EFGAP--EVLKLAERPT-PQPAAGEVLIKVAASGINRPDVFQRKGGYAPPPGASDLPGLEVAGEIVGGTIDEKNNGLKVGDRVCALLGGYAEYAVAPLLQCLPVPAGLSDVEAA----SLPETFFTVWSNVFDRAQLGKGPNETLLVQGGSSGIGVTAIQIAHALG-FRVFATAGSDEKCRA-CEALGAERAINYKTEDFVEVIKSLTNDGVDVVLDMVAGSYVSRELTALADGGRIVLIALLGGAKAELNLNEVLRRRLTVTGSTLRPRPIEF----KAKIAAQLKERVWPHLEDGRIKPVVHRVFPAAQAAEAHALMESSTHVGKIVLSWGQDA.. 349
240  5.000e-46 19  Xanthomonas campestris pv. campestris str. ATCC 33913 gi|21230216||ref|NP_636133.1| quinone reductase [Xanthomonas campestris pv. camp protmod 12 .............RNGKGDADALHAVEQA-RPQPAPGQVLIRVHAAGINRPDLLQRGGHYPPPPGAPETLGLEVAGE---VVVAAG--RWKVGDRVCALLGGYAQYAAVDARHVLPVPEGMTLVQAA----ALPETIFTAYANLFEHGRLAAG--EWLLLHGATSGIGVTAIQLAKAAGA--HVLATARSAGKAAQARELGADVAIDSTTESFVAAAKAHA--GVDVALDMVGASVFADTLEALNPGGRIVYIASQAGATLEVPIPLLMRKQAIITGSTLRPR-----NADEKARLAAEVERVWPWIAQGKVRVLIDQCFPLAEAAAAHRYLEQGSHLGKVVLEM...... 325
241  6.000e-46 18  Xenopus laevis gi|49256163||gb|AAH73591.1| MGC82892 protein [Xenopus laevis] protmod 1 ......MLAAFFDAPGGP--ETLYIKEVA-KPEPKEGEVLIKVEASALNRADLLQRRGK----YAPPPGSSDILGLEAAGTVVKLGDGSWKVGDGVMALLGGNAQYVTVPAGHLIPIPPGMSATDAA----AIPEAWLTAFQLLHFVGKVQKG--ETVLIHAGASGVGTSAIQLCRLAGA-VPIVTAGSPDKLQMAVK-LGAATGFNYKEENFGEKCLEFTNNGADVILDCIGGTHWEKNLQCIKTDGRWVLYGLMGSGE--------IHGDLLANLLRKRGSILGSLLRSRSKKYKEELEQALPHFMPGQLQPIVDSVFPLDQIADAHQRMEDNKNTGKIVLQM...... 330
242  7.000e-46 16  Danio rerio gi|22204224||emb|CAD43425.1| novel protein similar to human vesicle amine transp protmod 77 ..............TGYGGYDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPG--MECSGVIEAVGEEVTDRKVGDKVLVLNGMWQEVVVVASTHTFLMPEGMSFEEAA----ALPVNYITAYMMLFDFGHLRP--NQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTA--SASKHEVISQGGVTHPIDYRTRDYVEEVRKISPKGLDIVLDPLGGSDTHKGYNLLKPMGKLISYGAANMLAGQKKNLFAVAKTHTLSLIQGNRSVCGFHLGSETELIDQAMTAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILT....... 408
243  7.000e-46 18  Silicibacter pomeroyi DSS-3 gi|56676891||gb|AAV93557.1| quinone oxidoreductase, putative [Silicibacter pomer protmod 11 ..............EGFGGPEVLQLRDLPVGEP-GPGELRIRHQACGLNFIDVYQRTGL----YPLALPHALGMEAAGIVEAVGEGVTHLKPGDRAAYAPGAYAQARVMPAAQVCPLPDEISFDQAA----AMMLKGLTVDYLFHRTTPLSRGD--TVLFHAAAGGVGLIACQWAKAEGIT-LIGTAGSDE-KCALAKAHGATHVINYRTENFTDRVRELTDGGVDVVMDSIGADTFEGSLDCLKPLGMMISFGNASG-----PVPPVNIGMLGQKGSLKLTRPTLFTHISDHAACQAMARRLFGKVTGGEVKIRIDQRFPLDQVADAHRALEARQTTGSTILEL...... 327
244  8.000e-46 16  Danio rerio gi|42542740||gb|AAH66463.1| Vat1 protein [Danio rerio] protmod 77 ..............TGYGGYDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPG--MECSGVIEAVGEEVTDRKVGDKVLVLNGMWQEVVVVASTHTFLMPEGMSFEEAA----ALPVNYITAYMMLFDFGHLRP--NQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTA--SASKHEVISQGGVTHPIDYRTRDYVEEVRKISPKGLDIVLDPLGGSDTHKGYNLLKPMGKLISYGAANMLAGQKKNLFAVAKTHTLSLIQGNRSVCGFHLGSETELIDQAMTAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILT....... 408
245  9.000e-46 16  Danio rerio gi|56606041||ref|NP_001007052.2| vesicle amine transport protein 1 homolog (T ca protmod 77 ..............TGYGGYDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPG--MECSGVIEAVGEEVTDRKVGDKVLVLNGMWQEVVVVASTHTFLMPEGMSFEEAA----ALPVNYITAYMMLFDFGHLRP--NQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTA--SASKHEVISQGGVTHPIDYRTRDYVEEVRKISPKGLDIVLDPLGGSDTHKGYNLLKPMGKLISYGAANMLAGQKKNLFAVAKTHTLSLIQGNRSVCGFHLGYLTELIDQAMTAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILT....... 408
246  1.000e-45 18  Homo sapiens gi|13236495||ref|NP_001880.2| crystallin, zeta [Homo sapiens] gi|24660396|gb|AAH protmod 5 ...QKLMRAVRVFEFGGP--EVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDV--AGVIEAVGDNASAFKKGDRVFTISGGYAEYALAADHTVYKLPEKLDFKQGA----AIGIPYFTAYRALIHSACVKAG--ESVLVHGASGGVGLAACQIARAYGLK--ILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTI--EINPRDTMAKESSIIGVTLF--------SSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGGATGKMIL........ 327
247  1.000e-45 18  Silicibacter pomeroyi DSS-3 gi|56676890||gb|AAV93556.1| alcohol dehydrogenase, zinc-containing [Silicibacter protmod 6 ....RAVEISRPG-----GPEVLQLTQRP-RPEPGHGQVLIKVAYAGVNPDALQRAGAYDPPPGASDLPG---LECSGEVVAVGPGAEDVAVGDKVCALLGGYADYVVTPAAHCLPVPQGMALREAA----CLPETFFTVWSNVFTRGGLKAG--ERFLVHGGSSGIGTTAIQLAHAFGA-RVFATAGSDDKCRACLD-LGAERAINYRDEDFVKVMR--SEGGADLILDMVGGDYIPRNVKALAEDGRLVQIAFLQGPVVELNFALMMVKRLTLT----GSTLRPQSDLAKADIARDLREAVWPLLDAGRIAPVMDSEFDLGDAAAAHARMESSGHIGKIVLKVG..... 327
248  1.000e-45 16  Bordetella pertussis Tohama I gi|33593808||ref|NP_881452.1| putative alcohol dehydrogenase [Bordetella pertuss protmod 7 ............YEHGGPGS--IKYETAFPDPVAKPDEVILKVGAATLNYHDVFTRNGMPGITVPMPIIMGLDFAGEVV--EVGADVKDWKVGDRVLARHGGLAEYCAVPDHHLVRLPDDVSFETAV----CLPVAYGTAWRMMQTIGKIQSG--ERVLILGASGGVGTCCVQLAKMAGAE--VVAAASSPEKLARLTELGADHVIDYKQEDFMKAHRRLYENGVDVVVNFTGGDTWVKSLRTLHRNGRVLTCGATAGYDPKEDLRFIWSYELQILGSNGWTRDELIAL--------------LEQVRAGKLQPIVDRTYGLADINDAFRQLEDRQVFGKILVK....... 335
249  1.000e-45 18  Homo sapiens gi|58177596||pdb|1YB5|B Chain B, Crystal Structure Of Human Zeta-Crystallin With protmod 27 ...QKLMRAVRVFEFGGP--EVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDV--AGVIEAVGDNASAFKKGDRVFTISGGYAEYALAADHTVYKLPEKLDFKQGA----AIGIPYFTAYRALIHSACVKAG--ESVLVHGASGGVGLAACQIARAYGLK--ILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTI--EINPRDTMAKESSIIGVTLF--------SSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGGATGKMIL........ 349
250  2.000e-45 18  Pan troglodytes gi|55587266||ref|XP_513498.1| PREDICTED: similar to crystallin, zeta; NADPH:quin protmod 5 ...QKLMRAVRVFEFGGP--EVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDV--AGVIEAVGDNASAFKKGDRVFTISGGYAEYALAADHTVYKLPEKLDFKQGA----AIGIPYFTAYRALIHSARVKAG--ESVLVHGASGGVGLAACQIARAYGLK--VLGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEGIDVIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTI--EINPRDTMAKESSIIGVTLF--------SSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGGATGKMIL........ 327
251  2.000e-45 18  Geobacillus kaustophilus HTA426 gi|56419569||ref|YP_146887.1| NADPH:quinone oxidoreductase [Geobacillus kaustoph protmod 11 ..................GPDVLRVCEGERPKPTG-RQVVIEAEAIGVNYADTARREGRYVVPTPLPFIPGTEV--AGVVREVGPEVQTIRPGQRVVALIGGYAEFVAVDERAVVPLPDGMDARQAA----ALPVQGLSAYHILKTMGRLEEG--ETVLVHAAAGGVGTIAVQLAKRFGAKMVIATA-STEEKRALAKQLGADVTIDYTKDSWAADVMEATGGGVDVALEMAGGDVFHQTLDCLAPFGRLVVYGAASGEMTRLNPVRLMAKNWSVIGFFL------PQIMKKRALYEQSLRELLAWVQEGSLKLMIGGVYPLEQASEVHRLLQGRKTHGKLLL........ 322
252  2.000e-45 22  Oryza sativa (japonica cultivar-group) gi|51536218||dbj|BAD38389.1| putative NADPH oxidoreductase homolog [Oryza sativa protmod 305 .......................RLERVRLRLPVEPHNALVKIIYAGVNAFSAGRYFSGGAKETAARLPLDAGFEAVGIVASVGDSVNHIKVGSPVALMFGAYSEFTQVPAKHLLPVPRPDP------EVVAMLTSGLTASIALEKAGQMASG--QVVLVTAAAGGTGQFAVQLAKLAGNK--VVATCGGKCKAALLSSLGVDRVINYQNEKIKDVLKKEFPRGADIIYESVGGEMFDLCLNALAVHGRLIVIGMISQYQGEHGWKPRNYTGLCDKILAKSQTVAGFFLIQYAHLWQDHLDKLFDLYASGKLKVDPKKFVGVASAPDAVEYLHSGKSVGKVVVCIDPSYS. 628
253  3.000e-45 17  Mesorhizobium sp. BNC1 gi|45684361||ref|ZP_00195792.1| COG0604: NADPH:quinone reductase and related Zn- protmod 17 .............EHGGPM--VLKPEERPV-PKPGSGEILIKVRAAGVNRPDVAQRKGVYPPPPGASDLPGLEVSGIVAAT--GEGVERWHVGDEVTALTGGYAEFCVVHETNALPIPHGFTFTEAA----ALPETFFTVWHNVFERGGLKAG--ETLLVHGGTSGIGTTAIQVASNFGA-RVIATAGSAE-KCEACLKLGAARAVNYRAEDFVLAVKEATEGGADVILDMVGGDYIDRNYAAAAMDGRIVQISLQGGSKAEADFSKLMVKRLTHTGSTLRPRTIKF----KAHIAAELEAHVWPLLAARKVAPVMDTIFPLREAWRAHERMEEGAHIGKIVLDV...... 334
254  4.000e-45 19  Gallus gallus gi|50751136||ref|XP_422273.1| PREDICTED: similar to vesicle amine transport prot protmod 40 ........................LVQDLPAPRLQPRQVRVRVHYSGLNFADILACQGLYQEKHAPPFTPGMEFSGTVMET--GENVSAVKEGHRVIGVTGAMAEECVVDEKALWQIPDNVSSEDAA----VLPVAYGTAWLALHHRAHLQP--RETVLVTAGAGATGLAIIDLAVNVFQAKVIAAAGS-DPKCQLVLANGASHAVNYSQNSLREQVTALTGGGVDVAIEAVGGDIFKAVLQSLAWEGRIVVMGFAGGKIPSIPANLLLLKNVSAMGVYWSRYQQ-----EDFPLFSSAMSSLLQYGREGKIHPHIGAVFKLEEVNEAFNHVLQRKSTGKVII........ 347
255  4.000e-45 19  Xanthomonas axonopodis pv. citri str. 306 gi|21106917||gb|AAM35682.1| quinone reductase [Xanthomonas axonopodis pv. citri protmod 12 .............RDGKGDADAL-YATEQPRPRPAPGQVLIRVHAAGINRPDLLQRAGH----YPPPPGAPETLGLEIAGEIVEPAG-RWKVGDRVCALLGGYAQYAAVDARHVLPIPAGMDLVHAA----ALPETIFTAYANLFEHGRLAAG--QWLLLHGATSGIGVTAIQMAKAAGA--HVLATARSAVKAAQARELGADVAIDSTTASFVEVAKAH--GGVDVALDMVGAAVFADTLEALNPHGRIVYIASQAGATIEVPIPVLMRKQAVITGSTLRPRS-----ADEKARLAAEVERVWPWIEQGKLRVLLDKRFPLREAAAAHRYLEQGSHLGKVVLEM...... 325
256  4.000e-45 37  Apis mellifera gi|48098995||ref|XP_394852.1| similar to ENSANGP00000012490 [Apis mellifera] protmod 1 .............................................................MPSIFSYPIGSTMIGSQVGKIIESKNPNFPVGKKIIA-DVGWRSHTIINPFRCNRLLPDIQDLPMSLYLGVLGMPGNTAYFGLLEICKPKKG--ETLVISGAGGAVGSHVGQIGKILGLT-VVGIAGSDEKCKWLVKELGFDHAVNYKEGNLDVALRKAVPKGIDCYFDNVGGDISSIVMYQMKLNGRVAVCGSISSYHADASSLPK-ATILQPTMVFNELKVEGFLVSRWDNRWNEGIEKNLQWVREKKIRYRETVVKGFDNMFDAFVDMLEGKNIGKAIVQ....... 286
257  5.000e-45 18  Rhodobacter sphaeroides 2.4.1 gi|46191655||ref|ZP_00008127.2| COG0604: NADPH:quinone reductase and related Zn- protmod 8 ....RAIEISRPG-----GPEVLRPATVPV-PVPGHGQILIRVAYAGVNPDALQRAGAYAPPPGASPLPG---LEASGTVAAVGPGVTRWRVGEEVCALLGGYADYAVTPADHALPVPSGLTLREAA----CLPETCFTVWSNVALRGGLRAG--ERFLVHGGSSGIGTTAIQLAAALGA-RVFATAGS-EEKCAACRALGAERAINYREEDFVAVLKA--EGGADLILDMVGGSYLPRNVKALATEGRLVQIAFLEGTKVELNFAEVMMRRLTIT----GSTLRPQSDLAKARYARDIETQVWPLVARGALRPVIDSEFPIEQAAEAHARMEGSSHIGKIVLKL...... 328
258  6.000e-45 28  Debaryomyces hansenii CBS767 gi|49653573||emb|CAG85958.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 8 ...KKIVLNNAPSKEVGEESSTFRIERTTDKNSVKDGEMVIKMLYFSNDPAQKGWMQKGIKRMYLRILE-NDPVISLGLGEVVFSKSSKHSVGDKVTGRF-TWEEYIVVNEERITKTIDESLGLPLTSYLSSVGMTGLTAYFGVTKVGELKKG--QTIVISAASGATGSMCVQIAKHVGASKVVGISSSPK-KCKWVESLGADVCVNYHDTDYQKQLSDIIGDFVDVYYDNVGGEILSFMLSKVKQFGNIVACGAISGYNDAEKGEVTGWPEIT----RNRLTIRGFIIIDFIKDFAEGINAIVGAIKEGKINITEDVIDVLAKVPETWGLLFSNKKNGKLVTKIA..... 359
259  6.000e-45 17  Homo sapiens gi|47125273||gb|AAH70058.1| CRYZ protein [Homo sapiens] protmod 5 ...QKLMRAVRVFEFGGP--EVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLSYTPGSDV--AGVIEAVGDNASAFKKGDRVFTISGGYAEYALAADHTVYKLPEKLDFKQGA----AIGIPYFTAYRALIHSACVKAG--ESVLVHGASGGVGLAACQIARAYGLK--ILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTI--EINPRDTMAKESSIIGVTLF--------SSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGGATGKMIL........ 327
260  7.000e-45 20  Dechloromonas aromatica RCB gi|53729618||ref|ZP_00348476.1| COG0604: NADPH:quinone reductase and related Zn- protmod 24 ........AIRFHQTGGP--EVLSWEDVDL-PAPAPGEATVRHHAVGLNTYHRTGLYPLTLPSGIG-------MEGAGVVEAVGEGVGEVKVGDRVAGPLGAYAEVRNIPAHRLLKLPDSISFATGA----AMMLQGLTAAYLLRKTYRVQPGDAV--LIHAAAGGVGLIACQWAKALGAT-VIGTVGSSAKA-ELAKAHGCDHVINYSSENFTQRVREITAGGVAVVYDGVGKDTFIGSLDSLRPLGMMVSYGNASGPVPPLDLLLLSQKGSLFITRPTIATY-----TAKRADLEALGAELFDAVVSGKVRIEVNQTYALKDAAQAHRDLEARKTTGSTIL........ 342
261  7.000e-45 19  Azotobacter vinelandii gi|23104409||ref|ZP_00090875.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 .MAKRIQI----GRHGGP--EVLEWVDHT-APQPGPHEVRVRNRAIGLNFIDTYYRSGLYAPPRLPS---GLGLEGAGEVEAVGSAVERFKVGDRVAGPLGAYAELHVLPADKLVGLPDSIGFEQAA----AAMLKGLTVQYLLRQIGRFQGG--ETILFHAAAGGVGSIACQWAKALGV-RLIGTVGSPEKA-ERARALGAWATIDYSRENVASRVLELTDGRCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASGPVTGIDLGVLAQKGSLFVT-----RPTLAGYADTPERLQAMADELFAMLADGRVRVEIGQRFPLAEAARAQEALTSRRTTGSTIL........ 323
262  7.000e-45 17  Tetraodon nigroviridis gi|47218862||emb|CAG02847.1| unnamed protein product [Tetraodon nigroviridis] protmod 74 ..............TGYGGYDKVKLQVKKGKPALKAGELLVRVKACGLNFADLMARQGLYDRLPSPPVSPG--MECAGVVEAVGDEVTDRKVGDKVMVLFGLWQEVVVAPANHTFLIPEGMSFEQAA----ALPVNYITAYMMLFDFGNLRP--NQSVLVHAAAGGVGIAATQLCKTVKDVTVFGTA--SASKHETISEGGVTHPIDYRTKDYVEEVRKLSPKGLDIILDPLGGSDTHKAYNLLKPMGKLITYGAANMLAGQKKNLIAVAKNHTLSLIQGNKSVCGFHLGGETELITQAMNTILDLYKEGKIKPRIDSTWHFEQVGDAMRKMQERNNIGKVILT....... 405
263  8.000e-45 18  Mus musculus gi|13277837||gb|AAH03800.1| Cryz protein [Mus musculus] protmod 5 ...QKLMRAIRVFEFGGP--EVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDV--AGIIESVGDKVSAFKKGDRVFCYSGGYAEFALAADDTIYPLPETLNFRQGA----ALGIPYFTACRALFHSARARAG--ESVLVHGASGGVGLATCQIARAHGL-KVLGTAGSEEGKKLVL-QNGAHEVFNHKEANYIDKIKMSVGDGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRG--PIEINPRDTMAKETSIIGVSLS--------SSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGGKTGKMIL........ 329
264  8.000e-45 28  Nocardia farcinica IFM 10152 gi|54024221||ref|YP_118463.1| putative dehydrogenase [Nocardia farcinica IFM 101 protmod 4 .INRRLVLARRPEGRVRPT--DLELRTVALPDP-GPGQALVRNTWLSIDPSVRIRFAATTPRGYLPPLREGEPLAGLALGEVVASRHPGFAVGDLVSHTL-GYRDYAVVGADSAAPTRIDTDGLPPQWFLGPLGSAGLTAYVGLTAILELRPADTLW--VSAAAGAVGGLAAQLARLRGAT-VIGSAGGPAKVAFLRDELGI-AAFDYRACPPAAALAELAPAGLDAYFDNVGGEHLTAALDAMRAEGRIALCGAVAEYDGAGAAGPGNL----FQMVSKQLRMRGFRAGSFTDLEPAMRAEVAAHLRAGRLVHRETVFDGLERAADALCAMLAGETVGKTLCRL...... 341
265  9.000e-45 17  Exiguobacterium sp. 255-15 gi|45533212||ref|ZP_00184204.1| COG0604: NADPH:quinone reductase and related Zn- protmod 16 .........................QTEQPRPDVRPHDVLVEIHAASINPVDFKIRDGDVKL--LIPYQFPLILGNDFAGIIVEVGVKQFQVGDAVYGRIGTFAEYIAIDEQMLALKPASLSFEEAA----SIPLVGLTSYQALHDVLQATPG--QKILIQAGAGGVGTFAIQLAKAMGL--YVATTASSAG-HDLVASLGADEIIDYRTEAFDEVLHD-----YDGVYDTIGGETLRRSFKIVRPGGHIVSISGLPNGRFGKSYRSGFLKTNLFRLLTLRETWRVTYTFLFMRPSGRQLEHITEWIETGQIKPVIDRIYPFEEAQAALEYSESGRAKGKVVLQM...... 331
266  1.000e-44 18  Arabidopsis thaliana gi|42568692||ref|NP_200959.2| NADP-dependent oxidoreductase, putative [Arabidops protmod 81 ...KKMVKGIRVYEHGGP--EVLKWEDVEVGEP-KEGEIRVKNKAIGLNVYFRKGVYKPASMPFTPG------MEAVGEVVAVGSGLTGRMIGDLVAYAMGAYAEEQILPADKVVPVPSSIDPIVAA----SIMLKGMTAQFLLRRCFKVEPG--HTILVHAAAGGVGSLLCQWANALGAT--VIGTVSTNEKAAQAKEDGCHHVIMYKNEDFVSRVNDITSGGVNVVYDSVGKDTFKGSLACLKSRGYMVSFGQSSGSPDPIPLSDLAPKSLFLT------RPSMMHYNETRDELLECAGEVFANVTSGILKARVNHKYPLSRVADAHADLENRITSGSVVL........ 404
267  1.000e-44 19  Novosphingobium aromaticivorans DSM 12444 gi|48851304||ref|ZP_00305546.1| COG0604: NADPH:quinone reductase and related Zn- protmod 7 ..............HAAGGPETLVLDDLPD-PVPGKGEVLVRVHACSINFPDTLMIRDLYQFRPERPYAPGSELAGEI--EALGEGVTGWKVGDRVIAMIGGLAEKVIAPVARLFPLPDGVDYATGASLLMTYG----TTIHGLKDRGHIKAGD--TVLVLGAAGGVGLSAVELAKAFGA--RVIAAVSSEEKAQVVREAGADDVVIYGRPPFDKAQSKAGPNGADIVYDIVGGDYSEPALRAIAWEGRFLVVGFPAG-IAKLPLNLTLLKSCDVCGVFWGA-----WTAREPAAFKAEVEELFALLKAGKINPRVSQRFSLEQGREAIATLENRQAMGKVVVEM...... 331
268  1.000e-44 16  Pseudomonas aeruginosa UCBPP-PA14 gi|53726913||ref|ZP_00140425.2| COG0604: NADPH:quinone reductase and related Zn- protmod 1 .MAKRIQFAA------YGGPEVLEYRDYQPAEP-GPREVRVRNRAIGLNTYYRSGLYP------APGFPSGLGSEGAGEVEAVGSEVTRFKVGDRVAGPLGAYSELHVLAEEKLVHLPDGIDFEQAA----AVMLKGLTTQYLLRQTYELRGG--ETILFHAAAGGVGLFACQWAKALGV-QLIGTVSSPEKARL-ARQHGAWETIDYSHENVARRVLELTDGKCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASG-----PVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMADELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVL........ 323
269  1.000e-44 19  Rattus norvegicus gi|50926853||gb|AAH78927.1| Unknown (protein for MGC:93718) [Rattus norvegicus] protmod 5 ...QKLMRAIRVFEFGGP--EVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDV--AGIIESVGDGVSAFKKGDRVFCFSGGYAEFALSADNTTYPLPETLDFRQGA----ALGIPYFTACRALFHSARARAG--ESVLVHGASGGVGLATCQIARAHGL-KVLGTAGSEEGKKLVL-QNGAHEVFNHKEANYIDKIKSAGDKGVDVIIEMLANKNLSNDLKLLSCGGRVIVVGCRGSI--EINPRDTMAKETSIIGVSLFSST--------KEEFQQFAGILQAGIEKGWVKPVIGSEYPLEKAAQAHEDHSSGK-MGKMIL........ 327
270  1.000e-44 18  Mus musculus gi|33859530||ref|NP_034098.1| crystallin, zeta [Mus musculus] gi|1172801|sp|P471 protmod 5 ...QKLMRAIRVFEFGGP--EVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDV--AGIIESVGDKVSAFKKGDRVFCYSGGYAEFALAADDTIYPLPETLNFRQGA----ALGIPYFTACRALFHSARARAG--ESVLVHGASGGVGLATCQIARAHGL-KVLGTAGSEEGKKLVL-QNGAHEVFNHKEANYIDKIKMSVGDGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRG--PIEINPRDTMAKETSIIGVSLS--------SSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGGKTGKMIL........ 329
271  2.000e-44 18  Ralstonia metallidurans CH34 gi|48772226||ref|ZP_00276568.1| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................GPDVLAPVQRPV-PVPAADEVLIRIHAAGVNGPDVMQRRGLYDPPPGASDIPGLEVAGEIVS--VGRDVIRFAVGDLVCALVGGYAEYAVAHESNTLTIPEGLSMVEAA----ALPETFLTVWLNLFQRGKFSAG--ESVLIHGGASGIGTTATMLAKAFGASKIITTVGSDTQRDASI-ALGADVAVDYRNEDFVEAVARATDGGVDVVVDIIAGDYVARNYAAAAMDGRIVQIGVIKGPAQSLDLFPMLAKRLTHI----GSTLRSRTHEEKAVLIEDLEQSVFPHIRRGAVKPVMYKTFDLGDARRAHELMDSGTHIGKIVLT....... 325
272  2.000e-44 20  Azoarcus sp. EbN1 gi|56477930||ref|YP_159519.1| quinone oxidoreductase [Azoarcus sp. EbN1] gi|5631 protmod 4 ........AIRFHRTGGP--EVLQWEAVDVPPPAQ-GEARVRQHAVGLNYIDTY----HRTGLYPAPLPSGIGLEAAGVVEAVGEGVDDLAPGDRVAYAGGPLGAYANMPADRLVKLPDPVSFEQGA----AMMLQGLTAQYLLRRTYRVQPGD--TILIHAAAGGVGLIVCQWAKALGAT--VIGTVGTDEKAALARAHGCDHSIVYTRENFAERVREITGGGLPVVYDSIGKDTFMESLGCLRPLGMMVLFGAASG-----PVPPFDLGLLAKMGSLFITRPTLFTYSAKRPDLLAMAADLFEVVVSGKVRIEVNQRFALKDAAQAHRELEARRTTGSSIL........ 322
273  2.000e-44 20  Burkholderia pseudomallei K96243 gi|53718805||ref|YP_107791.1| quinone oxidoreductase [Burkholderia pseudomallei protmod 4 ........AIRYDQPGGP--EVMKWVDIDVG-APQPGEVRIKQHAVGLNYIDVYFRTGL----YPQPLPGGLGMEAAGEVTELGEGVTALKPGDRVAYVPGAYAQERVLAAAKLVKLPEAIGYEDAASA----MLQGLTAQYLLRRTYKVEPGD--TIVIHAAAGGVGLLVCQWAKALGAT-VIGTVGSDEKA-ALAKAHGCDHPIVYTRENFTERVKEITNGGVPVVYDSIGKDTYIGSLDCLAPLGMFVSFGNASG-----PLPPIDSKEFSSRGSLFFTRPTLFSYIAKREDLDRNAAELFDVLASGRVKTSIRQRYPLENVAQAHRDLEARRTTGSTVL........ 322
274  2.000e-44 20  Silicibacter pomeroyi DSS-3 gi|56679132||gb|AAV95798.1| oxidoreductase, zinc-binding dehydrogenase family [S protmod 12 ..................GPDSLSLENIAE-PVPGKGEVRIAVKAVGLNFPDLLIIRDLYQFKPPRPFAPGSELS--GIVESTGEGVTQLKAGDRVLAFWGGLAEQVVVPESRISRIPDQMPFEDAAAFMMTYG----TSYHALKDRAGL--GLGQTLLVLGASGGVGLAAVELGKILGA--RVLAAASSEDKLQTALDAGADDGLVYNKKELSTRFKELCGKGADVIYDPVGGDYSEPALRAIAWEGQFLVVGFPAG-IAKLPMNLPLLKACSVTGVFWGA-----AVERNPAQHAEATAELFDFYLKGKVKPKVEVMQGLENAAAALEKLSQRKVQGKLVVSLG..... 330
275  2.000e-44 23  Nostoc punctiforme PCC 73102 gi|23124709||ref|ZP_00106680.1| COG2130: Putative NADP-dependent oxidoreductases protmod 23 .......................EIVEIPLSKPAAS-ELVIQNKFAGVNFDTLLCRGDVPYINLIPPFDLG--VEAVGEVIAIGENVKDFQIGDAVIARGGGYREYQLINANLAVKV------REATPELLTLMPTGVSALVALEQVGEMK--SNEVVLVTAAAGGTGHIAVQLAKLAGN--HVIGTCSSEAKVKLLRELGCDRIINYRTENLNHVLKQEYPNGINLIFDCVGKQVFDTCVENLAIRGRLIVVGFISEYAKNVEQ--ITQPRLYHQLFWKAASVKGFLMPHYKEYIAEARDRLLNLFYTDKLKVSVDHFNGIESIPEAVEYLLRGQNCGKVVVR....... 334
276  3.000e-44 19  Xenopus tropicalis gi|49523188||gb|AAH75114.1| Crystallin, zeta (quinone reductase) [Xenopus tropic protmod 6 ....RVMRAIRVFEFG--KADVLKLCTDLPLPSPGKNEVLIRVHACGINPVETYIRAGTYARKPTLPYTPGTDV--AGVIESVGKDVTLFKRGDRVFTISGGYAEYSIASADTVYPLPDLLSFKQGA----AISIPYFTAYRALFSKAHGRPG--EVILVHGASGGVGIAACQIARAYG-FRVFGTAGTPEGLNLVLK-NGAHKVFNHREEDYIDKIQEATGGGVDVILEMLSNVNLSHDLNLLAAGGRVIIVGCRG--PIEINPRDTMAKETSIIGVSLF--------SATKEDRMETAAALFGGMEAGWLKPLIGCEYPLEKASQAHEDIQSSGASGKMVFVI...... 329
277  3.000e-44 21  Cicer arietinum gi|4958922||dbj|BAA78050.1| NADPH oxidoreductase homolog [Cicer arietinum] protmod 142 ........................VVRAPLRLPIKPNYVLVKIIYAGVNASDVNFSSGRYFGDTASRLPFDAGFEAVGVIAAVGDSVTDLKVGMPCAFMFGGYAEFTMIPSKYALPMPRPEPEGVAMLTSG------LTASIALEKAGQMESGK--VVLVTAAAGGTGQFAVQLAKLAGNT--VVATCGGGAKAKLLKELGVDRVIDYHSEDIKTVLRKEFPKGIDIIYESVGGDMLKLCLDALAVHGRLIVIGMISQYQGENGWTPSKYPGLCEKLLSKSQTVAGFFLVQYSHMYQEHLNKLFDLYSSGKLKVAVDRFIGLHSVADAVEYLHSGKSVGKVVVCVDP.... 461
278  3.000e-44 18  Mus musculus gi|28175436||gb|AAH43076.1| Crystallin, zeta [Mus musculus] protmod 5 ...QKLMRAIRVFEFGGP--EVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDV--AGIIESVGDKVSAFKKGDRVFCYSGGYAEFALAADDTIYPLPETLNFRQGA----ALGIPYFTACRALFHSARARAG--ESVLVHGASGGVGLATCQIARAHGL-KVLGTAGSEEGKKLVL-QNGAHEVFNHKEANYIDKIKMSVGDRVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRG--PIEINPRDTMAKETSIIGVSLS--------SSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGGKTGKMIL........ 329
279  3.000e-44 22  Nostoc sp. gi|25534798||pir||AH2431 oxidoreductase all5008 [imported] - Nostoc sp. (strain protmod 44 .......................EIVEVPI-PQVGIGQLLIENKFAGINFDTLVCRGDIPYFEIIPPFDLG--VEAVGKVVAVGENVTGFQIGDAVVTRGSGYREYQVIDANLAVKV------REATPEVLTLMPTGVSALVALEQVGEMT--SNEVVLVTAAAGGTGHIAVQLAKLAGN--HVIGTCSSEAKSKLLKALGCDRIINYRTENLDQVLKQEYPKGINLIFECVGKDVFDTCVDNLAIRGRLVSIGHISEYGKNV--EPVTQARIYHQLMWKAASVRGFLTPYYQEYIPEAGDRLLNLFYNGKLQVDPTQFNGLESIPTAVEYLLSGHNCGKVVVK....... 355
280  3.000e-44 16  Acinetobacter sp. ADP1 gi|50084895||ref|YP_046405.1| putative oxydoreductase protein, zinc-containing ( protmod 19 ...................PDVLHIVETSL-PKIKIDEILIEVKAFGINRPDVLQRKGLYPMPKDVTPIPGLEV--AGIVTAIGENVSQFKVGDRVCALTGGYAEYCAVPETQTLPIPSNLSYIEAA----AIPETYFTVWANLFDIGQLSVG--ETALIHGGASGIGTTALTLCHAMGI-KTFCTVGSDDKVDALNK---ITTAINYKKHNFEEVILETQNKGVDVILDIVGGKYFQQNMNTLKRDGRLVILGFMGGRYAKEFD---LQQLILKRAKVTGSTMRARTDQEKSEITQSLRQHVWPLLSEGKSLPLIYKSFSFEDISKAHTCMEESEHIGKIVITLTE.... 333
281  3.000e-44 21  Burkholderia cepacia R18194 gi|46311555||ref|ZP_00212160.1| COG0604: NADPH:quinone reductase and related Zn- protmod 4 ........AVRFHETGGP--EVLRWEEVDVGDP-GPGQVRLRHDAVGLNFADTYFRSGL----YPVPLPAGLGVEAAGVVEAVGPGVTNVAVGDRVTYTLGAYSTERLIPAAPLVRLPAGISCETAA----AMTMRGLTSAYLLRRIHAFAPGD--TILLHAAAGGVGLIVSQWAKLLGL--NVIGTVSSEHKAGIARAHGCDHTIDYSREDVAKRVRELTDGGVDVVFDSVGKDTFEGSLDSLKRRGLMVCVGTASGPI------PPFDPQRLAMKGSLYLTRPALYIADPAEKNDLA-GELFAHVAAGRIRIEINQRYALQDAAQAHRDLESRKTTGSSVFIV...... 326
282  3.000e-44 16  Pseudomonas aeruginosa PAO1 gi|9945842||gb|AAG03413.1| quinone oxidoreductase [Pseudomonas aeruginosa PAO1] protmod 1 .MAKRIQFAA------YGGPEVLEYRDYQPAEP-GPREVRVRNRAIGLNTYYRSGLYP------APGLPSGLGSEGAGEVEAVGSEVTRFKVGDRVAGPLGAYSELHVLAEEKLVHLPDGIDFEQAA----AVMLKGLTTQYLLRQTYELRGG--ETILFHAAAGGVGLFACQWAKALGV-QLIGTVSSPEKARL-ARQHGAWETIDYSHENVARRVLELTDGKCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASG-----PVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMADELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVL........ 323
283  3.000e-44 18  Xenopus laevis gi|49115886||gb|AAH73628.1| MGC82953 protein [Xenopus laevis] protmod 58 ...............................PVPKAGEVLVRVKACGLNFADLMARQGVYDRLPSLPVSLG--MECAGIVEELGEGVTDRQVGDKVMVLFGLWQELVTIQTNHTFLMPDGMSFEEGAAFL----VNYITAYMILFHFGNLRP--NQSVLIHMAAGGVGTAAVQLCKTVDNITIFGTA--SASKHENLKENGVLHPIDYRSNDYVEEVRKVSPKGVDIVMDPLGGTDTCKAFNLLKPMGTLVIYGAANLLTGQKKNIMALAKSWWMQLISANKSVCGFHLGHLDEELESVVSTLLDLYKQGKIKPKIDTMFSFEQVGDAMRQMQEKKNVGKVIL........ 371
284  4.000e-44 21  Pseudomonas putida KT2440 gi|26991886||ref|NP_747311.1| alcohol dehydrogenase, zinc-containing [Pseudomona protmod 14 .....................NLVLEEVA-SPLPKKNEILLDVQAAGVNFPDTLIIEGKYQFQPPLPFSPGG--EAAGVVAAVGEKAGAFKVGDRVMALWGAFAEQVAVPFYNVLPIPASMDFTTAAAF----GMTYGTSMHALRQRGQLQAG--ETLLVLGASGGVGLAAVEIGKAMGA-RVIAAASSAEKL-AVAKAAGADELIDYSQANLREEIKRLTGGGVDVIYDPVGGELFEQAVRGLAWNGRLLVVGFASGSIPQLAANLVLLKGAAVLGVFWGAFAQRQP-----EDNAANFHQLFAWHAEGKLKPLVSQTYPLAEAGVAIEKLGQRQAVGKLVV........ 322
285  4.000e-44 21  Xenopus tropicalis gi|56789562||gb|AAH88540.1| Hypothetical LOC496837 [Xenopus tropicalis] gi|58332 protmod 73 ........................LIPNAPVPVPGDGELLVRNRFVGINASDINYSSGRYDISTKPPFDAGF----EGIGEVVASASKTYTVGQTVAYVKGGFAEYT-VVPAKVAVPVPSVKPEYLTLLIS-----GTTAYISLKEMGQLSEGKKV--LVTAAAGGTGQFAVQLAKKSKC--YVIGTCSSDEKAGFLKSIGCDCPINYKTENIGSVLKNQFPDGLDVVYESVGGEMFDISVNRLATKGRLIIIGFISGYQTSQGLLPIKAGALPAVLLKKSASIHGFFLNHYLSEYKEAIMSLLKLYQNGELICEVDRFIGLESIFRAVDYMYTGKNIGKIVVEL...... 391
286  5.000e-44 16  Pseudomonas aeruginosa gi|695692||emb|CAA59375.1| quinone oxidoreductase [Pseudomonas aeruginosa] gi|10 protmod 1 .MAKRIQFAA------CGGPEVLEYRDYQPAEP-GPREVRVRNRAIGLNTYYRSGLYP------APGLPSGLGSEGAGEVEAVGSEVTRFKVGDRVAGPLGAYSELHVLAEEKLVHLPDGIDFEQAA----AVMLKGLTTQYLLRQTYELRGG--ETILFHAAAGGVGLFACQWAKALGV-QLIGTVSSPEKARL-ARQHGAWETIDYSHENVARRVLELTDGKCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASG-----PVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMADELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVL........ 323
287  5.000e-44 19  Burkholderia cepacia R1808 gi|46319550||ref|ZP_00219954.1| COG0604: NADPH:quinone reductase and related Zn- protmod 8 .............EFGAP--DVLKLTER-VRPEPARGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDLPGLEVAGEIVGGDLSDNPFGLKLGDRVCALLGGYAEYAVAPLPQCLPVPGGLTDIEAA----SLPETFFTVWSNVFDRALLGAGEGETLLVQGGSSGIGVTAIQIAHALG-FRVFATAGTADKCRA-CEALGAERAINYKTEDFVEVVKSLTHDGVDVILDMVGAAYLPRELSALADGGRIVLIALLGGAKAEINLGEILRRRLTVTGSTLRPRPVEF----KARIAAQLKARVWPLLADGRIKPVIYRVLPAGDAAQAHALMESGEHIGKIVL........ 333
288  5.000e-44 21  Ralstonia eutropha JMP134 gi|53762183||ref|ZP_00168002.2| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ............YETGGP--EVLRYEDMDVGEP-GPGQVRIRHVAVGLNYADTYFRNG----TYPVPLPAGMGVEAAGVVQAIGPGVTNVAVGDRVTYTLGAYSTERLVPAAPLIRLPETIGFETAA----AMTMRGLTSAYLMRRIYNFKAGD--TILLHAAAGGVGLIVSQWAKLLGLT--VIGTVSSEAKAEVARAHGCDYIINYSHEDVAKRVRELTDGGVSVVFDSVGKNTFMASLDSLKRRGTLVCVGTASGPI------PPFDPVLLAMKGSLFLTRPALADYGDPAEKAELAGEIFGHVGAGRIKIEINQRYALEDAVQAHRDLESRKTTGSSIFVI...... 320
289  5.000e-44 17  Streptomyces avermitilis MA-4680 gi|29608024||dbj|BAC72080.1| putative quinone oxidoreductase [Streptomyces averm protmod 11 ..................GPEALVWTEVPDPEP-GEGEVLVEVVASAVNRADLLQRQGFYAPP--PGASPYPGLECSGRIAALGPGVSGWAVGDEVCALLGGYAEKVAVPAGQLLPVPEGIGLRQAA----ALPEVTCTVWSNVFMVAHLRPG--ETLLVHGGSSGIGTMAIQLAKAVGAK--VAVTAGTKEKLDFCAELGADVLVNYREQDFVEEVRRATDGGADVILDNMGAKYLGRNVDALAVNGRLAIIGMQGGAKGELNIGALLHKRGAVTATSLRAR----PLGEKAAIVAAAREHVWPLIASGRVRPIVDRELPMSDAATAHRVLEESGHIGKVLLVV...... 325
290  6.000e-44 18  Mesorhizobium loti MAFF303099 gi|13470724||ref|NP_102293.1| quinone oxidoreductase [Mesorhizobium loti MAFF303 protmod 4 ........AIRIHAHGGP--EVLTYED-ADPGQPGSGQILVRHTAIGLNFIDVYHRSGLYPPPGGFPLIPGS--EAAGVVREVGEGVDWLKPGDRIAYNVGAYAEQRVIAAGLVVKIPDGISDEQAA----AMMLKGMTAEYLLRRTFKVKAGD--TILFHAAAGGVGLILGQWAKHLGAT-VIGTASSTD-KIELAKAHGFDHVINYREQDFVAGVAAITGGKCDVVYDSVGNDTFPASLDCLKPLGMFVSFGQSSG-----PIPPFSMSLLAQKGSLFATRPTLFVYNAKREDLDASAAALFDVVLSGAVKIQINQRYALKDAGKAHADLEGRRTTGTTIL........ 323
291  7.000e-44 18  Dictyostelium discoideum gi|42761520||gb|AAS45338.1| similar to Homo sapiens (Human). Quinone oxidoreduct protmod 21 ...........................TAPKPTPKNNEILVHVKSFALNRADILQRMGR----YPPPPGDSDILGLEMSGVVVEADDKRFKIGDKVFGLVGGYGEFCTIASNQAFHMPSHLTFESAS----AIPEAWLTAFQALHPLANFKSGNSV--LIHAAASGVGTALIQLCKVDGATKIIGTVGSDEKAKFIEK-LGATHSVNYKTENFLDVINDVTKKGVNNVFDYVGAKYWNQNLKSLSMDGVMIIQGFLSGSHIKDTAADITPILGKRLTI-KGSTLRNRDNDYKADLVAQFSKRYLTLFESGELKPIVDKVFNVSEIKEAHEYLEANKNMGKVVVK....... 331
292  7.000e-44 17  Cavia porcellus gi|117549||sp|P11415|QOR_CAVPO Quinone oxidoreductase (NADPH:quinone reductase) protmod 5 ...QKLMRAIRVFEFGGP--EVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDV--AGVVESIGNDVSAFKKGDRVFTISGGYAEYALASDHTVYRLPEKLDFRQGA----AIGIPYFTACRALFHSARAKAG--ESVLVHGASGGVGLAACQIARAYGLK--VLGTAGTEEGQKVVLQNGAHEVFNHRDAHYIDEIKKIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVGCRGSIEINPRDTMAKESTISGVSLFSST----------KEEFQQFASTIQAGMELGWVKPVIGSQYPLEKASQAHEIIHSSGTVGKTVL........ 327
293  7.000e-44 18  Burkholderia cepacia R18194 gi|46311319||ref|ZP_00211927.1| COG0604: NADPH:quinone reductase and related Zn- protmod 4 ........AIRYDQPGGP--DVMKWVDVEVGEP-KAGEVRIRQHAVGLNYIDVYFRTGL----YPQALPGGLGMEAAGEVTAVGEGVTTLKAGDRVAYVPGAYAQERVMPADRLVKLPDGISYDDAA----SVMLQGLTAHYLLRRTYPVKAGD--TILIHAAAGGVGLLVCQWAKALGAT-VIGTVGSDEKA-ALAKAHGCDHPIVYTRENFTQRVKEITNGGVPVVYDSIGKDTYIGSLDSLAPLGLFVSFGNASG-----PLPLIDSKEFSSRGSLFFTRPTLFSYIAKRADLESAAAELFDVLLSGKVKTSINQRYPLAEVARAHEDLEARKTTGSTIL........ 322
294  7.000e-44 20  Vigna unguiculata gi|1617036||emb|CAA69914.1| Ted2 [Vigna unguiculata] gi|7430955|pir||T11672 quin protmod 2 ......VKAIRVHEQGGPQ--VLKWEDVEIGEP-KEGEVRVRNKAVGVNVYFRKGVYKPPSFPFTPG------MEAVGVVTAVGAGLTGRQVGDLVAYAMGSYAEEQILPANKVVPVPSSIDPPIAA----SIMLKGMTTHFLVRRCFKVEPG--HTILVHAAAGGVGSLLCQWANALGAT--VIGTVSNKEKAAQAKEDGCHHVIIYKEEDFVARVNEITSGGVEVVYDSVGKDTFEGSLACLKLRGYMVSFGQSSGSPDPVPLSSLAAKSLFLT------RPSLMQYVVTRDELLEAAGELFANVASGVLKVRVNHTYPLSEAAKAHEDLENRKTSGSIVL........ 322
295  7.000e-44 19  Bordetella parapertussis 12822 gi|33597033||ref|NP_884676.1| quinone oxidoreductase [Bordetella parapertussis 1 protmod 1 .MASNIVKAVRIEQHGGP--EVLQVVDVEVPPP-AANEVTIRQHAAGLNFIDIYFRTGL----YPHPLPHGLGFEGAGVVEAVGADVRHLKKGDRVAYGLGAYAQARNVPAAQVVKLPKGIGFDEAA----ALMLKGLTVQYLFRQTYRLQ--GNETILFHAAAGGVGLIACQWAKALGV-KLIGTVSSPEKA-ELARAHGAWATIDYSRENVVERLLELTGGKVPVVYDGVGKDTWETSLDCIEPRGLMVSFGNASGPVAGVNLGILNQKGSLYVT-----RPSLGVHVNTHEKLAAAADELFGLVLKKKIKVRIDQRYSLAQAGDAQTALAGRKTTGATVLTLD..... 329
296  8.000e-44 19  Canis familiaris gi|57031538||ref|XP_533369.1| PREDICTED: hypothetical protein XP_533369 [Canis f protmod 56 .............................PVALPGDRDLLVRNRFVGVNASDINYSAGR----YDPSVKTPFDVGFEGVGEVVASASARYTVGQAVAYMPGSFAEYTVVPASAAAPVP------SVKPEYVTLPVSGTTAYISLNELGGLSEGKKV--LVTAAAGGTGQFAVQLAKKAKC--HVIGTCSSDKKSAFLKSIGCDRPINYHTEHVSTVLKQEYPTGVDVVYESVGGAMFDLAVDALAIKGRLIVIGFVSGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHSLSKYQAAMDHLLKMYAGGDLVCEVDRFRGLESVFRAVDYMYMGKNTGKIVVELPRS... 372
297  9.000e-44 22  Brucella suis 1330 gi|23463927||gb|AAN33760.1| quinone oxidoreductase [Brucella suis 1330] gi|23500 protmod 4 ........AIRVHRTGGP--DVLHYEQVEIGEP-GPGEARVRHEAVGLNVYFRTGLYKAAKMPFTPGN------EGAGIVVAVGAGVENVRVGERVAATPGSYADERILPADRLVKVPDTIDLKTAA----SMMLKGMTAQYLLRRTFRVEPG--QTILFHAAAGGVGLIAGQWAKHLGAT-VIGTAGS-EEKIALARKHGYDHVINYRSENFVERVRELTNGGVDVVYDSVGRDTYMGSLDVLKPLGMFACFGQSSG------VIPPFDLGILAQKGSLFATRPTFNYIARRADLEKTTAELFDVVESGAVKIEINQTYALKDACKAHEALEARKTTGTSIL........ 322
298  9.000e-44 19  Pongo pygmaeus gi|55733110||emb|CAH93239.1| hypothetical protein [Pongo pygmaeus] protmod 5 ...QKLMRAVRVFEFGGP--EVLKLQSDIAVPIPKDHQALIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDV--AGVIEAVGGNASAFKKGDRVFTISGGYAEYALAADHTVYKLPEKLDFKQGA----AIGIPYFTAYRALIHSAHVKAG--ESVLVHGASGGVGLAACQIARAYGLK--VLGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEGIDVIIEMLANVNLNKDLSLLSHGGQVIVVGSRGTI--EINPRDTMAKESSIIGVT--------VFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGGATGKMIL........ 327
299  1.000e-43 20  Rubrobacter xylanophilus DSM 9941 gi|46105701||ref|ZP_00199641.1| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ............HENGEPER-VLRLEEVEE-PSCGPGEALIEVEAASLNFLDVLLCRGGYQERPEPPFIPG----AEAAGRVLEAGPTGLEPGGRVVALTGAFAERVAVPATGLFPVPEEMPPEKAA----ALPIVYQTAHFALHRRAGLEAG--ETVLVHAGAGGVGSAAIQLARAAGA-RVIATAGSEEKLR-ICRGLGAELALDYRRQDVIGAVKEATGGGADVVFDPVGGDVFDASRRCVAFEGRLLVIGFAGGRIAEAPTNHVLLKNYSVVGV-----HWGLYQSVMPELVREVHEELLGLYASGEIDPLIGEAVPFEELPAALARLGAGRTVGKVVARVG..... 321
300  1.000e-43 19  Bordetella pertussis Tohama I gi|33593279||ref|NP_880923.1| quinone oxidoreductase [Bordetella pertussis Toham protmod 1 .MASNIVKAVRIEQHGGP--EVLQVVDVEVPPP-AANEVTIRQHAAGLNFIDIYFRTGL----YPHPLPHGLGFEGAGVVEAVGADVRHLKKGDRVAYGLGAYAQARNVPAAQVVKLPKGIGFDEAA----ALMLKGLTVQYLFRQTYRLQ--GNETILFHAAAGGVGLIACQWAKALGV-KLIGTVSSPEKA-ELARAHGAWATIDYSRENVVERLLELTGGKVPVVYDGVGKDTWEISLDCIEPRGLMVSFGNASGPVAGVNLGILNQKGSLYVT-----RPSLGVHVNTHEKLAAAADELFGLVLKKKIKVRIDQRYSLAQAGDAQTALAGRKTTGATVLTLD..... 329
301  1.000e-43 22  Magnetospirillum magnetotacticum MS-1 gi|23014744||ref|ZP_00054546.1| COG0604: NADPH:quinone reductase and related Zn- protmod 5 ........AIRIHQPGGP--EVMVWEEVDLA-APGAGQVLLRHTAVGLNVYHRTG-------LYPAPLPFTPGLEGAGIVEAVGDGVTELKAGDRVAYANPPLGAYSVMPADRLVKLPDHIHDRTAA----AMMLQGMTAQYLLRRTYRVQPGD--TILIHAAAGGVGLLVCQWAKHLGAT-VIGTVGSEEKA-ALAKAHGCDHTILYKSEDFVARVKEITKGGVPVVYDSVGKDTFLNSLDCLRPLGMMVLFGQSSGKVEPFDTGLLGAKGSLFLT-----RPSLMAYTAKRSDMVASASELFEVVGKGVVKVEINQTYSLKDAAQAHRDLEARKTTGSTLL........ 323
302  1.000e-43 16  Rubrivivax gelatinosus PM1 gi|47574920||ref|ZP_00244955.1| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................GPEVLRLVERPEPEP-GPGELLIDVAAAGVNPDVLQRAGAYPPPPGASDLPGLEVAGRIVGGDAGALAAAGFRLGDRVCALTGGYAQRCVAPVGQCLPVPAGWSDIEAA----SLPETLFTVWINVFERARLQPG--ETLLVQGGASGIGVTAIQLAKAFGC--RVFVTVGDDARAQACRAIGADEAINYRTRDFVAEVERLTGGGVDVILDMVAGSYVARELRCLADDGRLSIIAVQGGTKAEFDAGA---------LLRRRLTITGSTLRPRTTEYKAAVARVWPLIEAGRFKPMIHKTFPAAQAAQAHELMESGQHVGKLVLT....... 327
303  1.000e-43 16  Photorhabdus luminescens subsp. laumondii TTO1 gi|37526244||ref|NP_929588.1| hypothetical protein plu2342 [Photorhabdus lumines protmod 10 ....QYMLAISIIKPGGP--EKLHLVQVPL-PRPGKGYLLVKVAAAGVNRPDIFQRMGSYPPPPDASPLPGLEIAGEVVAK--GEGCERWNLGDKVCALVGGYAEYCLVHDSVALPI-YGLDFVQAA----ALPENFFTVWANVFQTGQLKPG--ENLLIHGGTSGIGSVTIMLAKAFGAK--VITTVGSDEKAKVAHSLGADFVINYHKEDFVDRVLKITGNGVDMVVDLIGGDYVNKNYKVAAKFGRIIQIGMMKGN----PENLNLMPLMLKRLTHTGSTLRSRSVEEKAEIAKELEKQVWPLLKSGKVTPLICKVFDLKDAADAHRMMEAGDVIGKVML........ 333
304  1.000e-43 20  Streptomyces coelicolor A3(2) gi|11071272||emb|CAC14345.1| putative zinc-binding oxidoreductase [Streptomyces protmod 8 ............GQDVLGGPEVLK-EVRPERPEPRPNEVLVRVRAAGVNPTDW-KHRATGGFLGEPPFVLGWDVS--GVVESVGIGVAAFRPGDEVFGMHGSHAEYVTAPARTFTRKPSGIDHVQA----GALPLVSLTAWQALVERAEVQPG--QRVLVHAAAGGVGHVAVQIAKARGA-RVIGTA--SAAKHEFLRSLGADETVDYRETDFAEAVKD-----VDVVLDTIGGDTSLRSLRVLRPGGVVVSI---------LPVGSDDFYEEADRLGVRAVRM-------LVDADRAGMEEIARLVGAGRLRATIAQTFPLAEAARAHALGETGRTTGKLVLEVD..... 313
305  2.000e-43 17  Ustilago maydis 521 gi|46096283||gb|EAK81516.1| hypothetical protein UM00131.1 [Ustilago maydis 521] protmod 82 .............KDGKGPSDNLYLGEAPVPE-LGEDEVLVKIKAFGLNRMDIMQR----EGNYPLPPHAPQIMGVEFSGHIVATNKPKWKVGQEVFGLGGAYAEYIKVPSRMILEKPGELDWVQAA----AIPENYLTAFQALRTIGGLQRGEDV--LIHAGASGVGLAAIQLARAFGAGKVYITAGS-EDKIKFCQEVGADKGFNYKAVDWAEELAKHTGGSVDVIVDFIGAPYFNGNLQSLKRDGRMILLAFMGGAK--------IKETVLAQILFKRLRIEGSTLRSRSVEYQSNLVQGF--VEEKGLRLVIHKVYSWKDIKEAHDEMEANKNIGKIVITIDD.... 421
306  2.000e-43 21  Burkholderia fungorum LB400 gi|48784270||ref|ZP_00280636.1| COG0604: NADPH:quinone reductase and related Zn- protmod 3 ......VKAIRFDKTGGP--EVMKWVDVEVGEP-GAGEIRVRQTAVGLNYIDVYFRTGL----YPLPLPGGLGMEAAGEVTALGSGVSGLKVGDRIAYVPGAYAQERVLQAAQVVKVPDALTDEQAA----SVMLQGLTAQYLLRRTYPVKAGD--TILIQAAAGGVGLLVCQWAKALGAT-VIGTVGSDEKA-EIATAHGCDHAIVYTRENFTRRVREITNGGVPVVYDSIGKDTFTGSLDCLAPLGMFVSFGNASG-----PLPPIDSSEFAGRGSLFFTRPTLFTYIAKRSDYEAMSTELFDVLVSGKVKTSINQRYALADVGRAHADLEGRRTTGSTVL........ 323
307  2.000e-43 23  Aspergillus nidulans FGSC A4 gi|40746875||gb|EAA66031.1| hypothetical protein AN0158.2 [Aspergillus nidulans protmod 13 ............EKTGGP--EVLEVRTHHPVPTASEGQLLVKNQIIGINTYFRTGLYPSSK-----PEILGREAVGEVVAVGPGANPYNFQIGDRVAWLTGSYAEYTAVPQAFAVKVPEGISNED----VMGSFLSGLTVLTLAKETYPVQRGD--WVLLHAAAGGAGFLMTQVLKSIGAI-VIGTAGGPEKV-ELVKSLGADYVIDYRSEDWVKKVKEITNGGVDVVYDSVGKDTWEGSLEAVKRKGMIVWFGNASGPVPPLPLAKLSPKCV------KVARPQLFGYIQAREEFEFYVNELFNMLKSGNLKVKIHKVYPLEQVAEAHSDLEGRKTTGKLLLK....... 331
308  2.000e-43 19  Bradyrhizobium japonicum USDA 110 gi|27376614||ref|NP_768143.1| quinone oxidoreductase [Bradyrhizobium japonicum U protmod 10 .....VVAISKPG-----GPEVLVPEQRAL-PQPGPDEILVKVQAAGVNRPDVAQRSGAYPPPPGASDLPGLEIAGEVVA--VGGNAKRHKIGDKVMSLVGGYAQYCIAQDAQAMSVPPALSIKEA----GALPETLMTVWHNVFERGGLKAG--ETLLIHGGSSGIGTMAIQLAKAFGAKVFVTV--GSQDKIDACLKLGADRAINYKTEDFVAVVKETGNAGVNLILDMVAGEYVDRNYDAAAVDGRIVQIATLNGPKVSVN----IAKVMVKRLTHTGSTLRPRSNADKAAMVAAIEAKVMPLLREGRVKPVMDSAFPLEKAADAHRRMETSAHIGKIVL........ 330
309  2.000e-43 20  Thermus thermophilus HB8 gi|55980435||ref|YP_143732.1| alcohol dehydrogenase [Thermus thermophilus HB8] g protmod 2 ...RAVVMRAR------GGPEVLEVADLPVPEP-GPKEVRVRLKAAALN-HLDVWVRKGVASPKLP---LPHVLGADGSGVVVGPGVEGFAPGDEVVHRHGTYAEYVVLPEANLAPKPKNLSFEEAA----AIPLTFLTAWQMVVDKLGVRPGDDV--LVMAAGSGVSVAAIQIAKLFGA-RVIATAGS-EDKLRRAKALGADETVNYTHPDWPKEVRRLTGGGADKVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFYRQLSILGSTMASKSRLFPI--------------LRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVLQVG..... 343
310  3.000e-43 20  Thermus thermophilus HB27 gi|46198405||ref|YP_004072.1| alcohol dehydrogenase [Thermus thermophilus HB27] protmod 2 ...RAVVMRAR------GGPEVLEVADLPVPEP-GPKEVRVRLKAAALN-HLDVWVRKGVASPKLP---LPHVLGADGSGVVVGPGVEGFAPGDEVVHRHGTYAEYVVLPEANLAPKPKSLSFEEAA----AIPLTFLTAWQMVVDKLGVRPGDDV--LVMAAGSGVSVAAIQIAKLFGA-RVIATAGS-EDKLRRAKALGADETVNYTHPDWPKEVRRLTGGGADKVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFYRQLSILGSTMASKSRLFPI--------------LRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVLQMG..... 343
311  3.000e-43 19  Pseudomonas fluorescens PfO-1 gi|48731351||ref|ZP_00265096.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 .MAKRIQFR----AHGGP--EVLEYVDYQPAEP-GPQQVRVSNKAIGLNFIDTYYRSGLYAPPALPS---GVGAEGAGIVEAVGSEVTRFKVGDRVAGPLGAYSDVHVLPEANLVHLPDAISFETAAG----VMLKGLTVQYLLRQTYELKGG--ETILFHAAAGGVGLLACQWAKALGV-KLIGTVSSKAKA-DLAKAHGAWETIDYSHENVAQRVLELTDGKVPVVYDGVGKDTWPASLDSVAPRGLLVSFGNASGAVDGVNLGILAAKGSLYVTRPTLATY-----ANNAENLQRMADELFGMITSGKLKVDISQRYPLADAAKAQTELSARRTTGSTVL........ 323
312  3.000e-43 36  Homo sapiens gi|1088448||dbj|BAA08382.1| NADP dependent leukotriene b4 12-hydroxydehydrogenas protmod 5 ...KTWTLKKH--FVGYPTNSDFELKTAEL-PPLKNGEVLLEALFLTVDPYMRVAAKRLKE---------GDTMMGQQVAKVVESKNVALPKGTIVLASP-GWTTHSISDGKDLEKLLTEWPDTPLSLALGTVGMPGLTAYFGLLEICGVKGG--ETVMVNAAAGAVGSVVGQIAKLKGCK--VVGAVGSDEKVAYLQKLGFDVVFNYKTESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQ---ELRMEAFVVYRWQDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPR........................ 311
313  3.000e-43 22  Kluyveromyces lactis NRRL Y-1140 gi|50303049||ref|XP_451462.1| unnamed protein product [Kluyveromyces lactis] gi| protmod 27 ...QKVVLIR---ENGGP--EVLKYEEDYPVPKIGATDLLIKNKYAGINFI------EVYFRKGIYPSEKPYVLGREAVGEVVAKGVDKYNVGDKVAYLSSTFAQFTKYPQNHLIKLPKDISAEKEKIIAGSLV-QGLTPLTFIDEAYNVQKGDF--ILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQL-AKEYGAEFLINSTKDDIVEKVKEFTNGGVAAAFDSIGKDTFETTLQVVKRKGTIVSFGNASGAVPPFSINRLSPKNL------KLVRPQLFAYVADPSEWEHYSSELIRLIDSGELKITISKVYPLKDYKEATEDLESRKTVGKLILEIPE.... 353
314  3.000e-43 18  Oryza sativa (japonica cultivar-group) gi|50915650||ref|XP_468289.1| putative quinone oxidoreductase [Oryza sativa (jap protmod 2 ...RAVVIAR------AGGPEVLEERDVGELPPPGEGEVLVGVSAAGVNRADTVQRQGRY--PAPPGASPYPGLECSGTILALGPNVPRWAVGDQVCALLGGYAEKVVVPAGQLLPVPEGVSLTDAAG----LPEVACTVWSTVFVTSHLSP--SESFLIHGGSSGIGTFAIQIAKHLGIK--VFVTAGSEEKLAACKGLGADVCINYKTEDFVARVKEETNGGVDVILDNIGGLYLQRNLNSLAVDGRLFIIGFQGGAVTEVNLQPMLARRLTIQLRNRSLDNKALIVSEVEKNV-------WPAVVQGKVKPVIYKTFPLSEAAEAHKLMEESSHIGKILL........ 326
315  3.000e-43 19  Ralstonia solanacearum gi|17429084||emb|CAD15772.1| PUTATIVE NADPH QUINONE OXIDOREDUCTASE OXIDOREDUCTAS protmod 11 ..................GPDVLKPAERPMPEP-KAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDIPGLEVAGEIVGGDLAHADNGLRAGDRVCALVGGYAEFCTAPLGQVLPVPAGLSDIEAA----ALPENYFTVWSNVFDRGQLGQGKGETLLVQGGSSGIGTTAIQMASALG-YRVFATAGSDEKCAACV-ALGAARAIRYRTEDFAEVVKAETGRGVDVVLDMVGGSYVAREIACTADDGRIVLIALLGGAKAEVPLGEILRRRITLT----GSTLRPRPVAFKAAIAAHLHDTVWPLLASGRIRPVIHEVMPAEHAAQAHALMESSAHIGKIMLT....... 332
316  3.000e-43 19  Streptomyces avermitilis MA-4680 gi|29611120||dbj|BAC75164.1| putative dehydrogenase [Streptomyces avermitilis MA protmod 17 ..................GPEVLKEVETE-RPAPRPNEVLVRVRAAGVNPTDW-KHRATGGFLGEPPFVLGWDVS--GVVEATGIGVARFKPGDEVFGMHGSHAEYVTAPARAFAHKPSGVDHIQA----GALPLVSLTAWQALVETADVRPG--QRVLIHAAAGGVGHVAVQIAKARGAY---VIGTASAGKHDFLRGLGVDETIDYRETDFAEAVRD-----VDIVLDTIGGDHSLRSLRVLRPGGIVVSI---------LPVGSDDFYEEAERLGVRALRM-------LVDASHTGMKAIAELVEAGKLRATIAETFPLADAAKAHALGDTGRTTGKLVLTM...... 315
317  3.000e-43 18  Xenopus tropicalis gi|51513478||gb|AAH80442.1| VAT1 protein [Xenopus tropicalis] protmod 85 ...............................PTPKAGEVLVRVKACGLNFADLMARQGVYDRLPSLPVSLG--MECAGIVEELGEGVTDRQVGDKVMVLFGLWQELISIQTNHTFLMPDGMSFEEGAAFL----VNYITAYMILFHFGNLRP--NQSVLIHMAAGGVGTAAVQLCKTVENITIFGTA--SASKHESLKESGVSHPIDYRSNDYVEEVRKVSPKGVDIVMDPLGGTDTCKAFNLLKPMGKLVIYGAANLLTGQKKNLMALAKSWWMQLINANKAVCGFHLGHLDDELELIVVTLLDLYKQGKIKPKIDTMFSFEQVGDAMRQMQEKKNVGKVIL........ 398
318  3.000e-43 17  Bacillus halodurans C-125 gi|10172976||dbj|BAB04082.1| quinone oxidoreductase [Bacillus halodurans C-125] protmod 7 ..............TAFGGPEHMMWEDVST-PVIKENEVLIKVVKTSVNFADIKARYGRKGGT--LPFIPG--LDAAGYVEKVGREVSDIQVGQRVIAFPGSYAEYVVAAESLVFPIPDEINFRTAA----ASPIVSFLSHRLLYNVAQMERG--ESVLVHAAAGGVGTTAIQMAKLLGAGTVIGTVGSADKITA-AKESGADEVICYEEEDFTKSVQEMTNGGVDIILDSVSGSVTEKSLQCLARYGRLVHFGNSSGAIGTIKTIDLHASCRSVLGFSLGTTRKC-----KPHLLKETARHVLPYLASGKLKVHIGHEYRLTDAANAHRLMESRLNRGKILLNV...... 323
319  4.000e-43 20  Ralstonia eutropha JMP134 gi|53762421||ref|ZP_00168336.2| COG0604: NADPH:quinone reductase and related Zn- protmod 4 ........AIRIEQTGGP--EVMQWVDVEVGEP-GPGEVRVRHEAVGLNFIDVYFRTGL----YKQPLPGGLGMEGAGVVEAVGEGVAHLSVGDRVAYANGAYSQVRVMPADIVVRLPESISFEQGA----AMMLQGLTVQYLIRDSYRVQAGD--TVLLHAAAGGVGLIACQWLKALGVT-VIGTVGSDEKA-ELARAHGCTHTVVYTRESFVDRVKEITGGGVPAVYDSIGADTFRGSLDCLAPRGTMVSFGSASG-----PVPPFDISVLGNKGSLRLTRPTLMTYVVHRELLEPMVADLFDVVSSGKVKIDVRQRYALADVAQAHRDLESRKTTGSTIL........ 322
320  4.000e-43 17  synthetic construct gi|30585219||gb|AAP36882.1| Homo sapiens quinone oxidoreductase homolog [synthet protmod 1 ......MLAVHFDKPGGP--ENLYVKEVA-KPSPGEGEVLLKVAASALNRADLMQRQG----QYDPPPGASNILGLEASGHVAELGPGHWKIGDTAMALLGGQAQYVTVPEGLLMPIPEGLTLTQAA----AIPEAWLTAFQLLHLVGNVQAGDYV--LIHAGLSGVGTAAIQLTRMAGAIPLV--TAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQ----RLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL...... 330
321  4.000e-43 15  Mesorhizobium loti MAFF303099 gi|13473234||ref|NP_104801.1| NADPH quinone oxidoreductase [Mesorhizobium loti M protmod 18 ..........................ETRDVPQPGPGEILIKVHAAGVNRPDVQQRKGAYPPPPGASDLPGLEVSGEVAA--LGDEISRWRIGDRVCALTGGYAEYVKVHSGSVLPLPAGFTHTEAA----AVPENYFTVWHNVFERGALKKG--ETLLVHGGSSGIGTTAIQLASAFGA--YVITTAGSKEKCDACLKLGADRAINYREEDFVTAVKEATDGGATVILDMVGGDYVQRNYEAAAVEGRIVQIAVQAGAVASADFSKIMVKRLTHTGSTLRPRTVEF----KAAIAAALEAQVWPLLGTRKVAPVMDMIYPLTDAWRAHERMEEGEHIGKIVLDVG..... 326
322  4.000e-43 20  Gibberella zeae PH-1 gi|42544508||gb|EAA67351.1| hypothetical protein FG10124.1 [Gibberella zeae PH-1 protmod 13 ...............GTGERDALFINDKTPKPSAAEGQAIVKIKAFGINRMDIIQRRGFYPLPPQAPKTLG--VEFSGIIESFGPGDHGFTEGDEVFGLGGAYAEYIAVSTRMLLHKPSSIDFTTCAG----VPEAWITATQALHLVLGFTKGK--SILWHAGASGVSVAGIQLSRVAGASAVYATAGSQDKLDFITSKLGATAAFNYKTQDWAEEIKKATGGGVDYIVDFVGGNYFQKNLDVAARDGRMVLLGTLSGAK--------VPDADISQILFKRLRIEGSTLREYQGELRDRLEKYIPEFESGNLKIFVDEVFPWEQIQEAHKHMEDAKNLGKIICTIS..... 335
323  4.000e-43 18  Gibberella zeae PH-1 gi|58428024||gb|AAW77061.1| quinone reductase [Xanthomonas oryzae pv. oryzae KAC protmod 12 .............RDGKGDADAL-YATEQPRPRPAAGQVLMRVNAAGINRPDLLQRAGH----YPPPPGAPETLGLEIAGEIVEPAG-RWKVGERVCALLGGYAQYAAVDARHVLPIPAGMDLVHAA----ALPETIFTAYANLFEHGRLAAG--EWLLLHGATSGIGVTAIQMAKAAGA--HVLATARSASKAAQARALGADVAIDSTSESFVEVAKAH--GGIDVALDMVGAAVFADTLEALNQRGRIVYIASQAGATIELPIPVLMRKQAVITGSTLRPR-----TADEKARLAAEVERVWPWIAEGKLRVLVDKRFPLAEAAAAHRYLEQGSHLGKIVLEI...... 325
324  4.000e-43 17  Homo sapiens gi|30583137||gb|AAP35813.1| quinone oxidoreductase homolog [Homo sapiens] gi|225 protmod 1 ......MLAVHFDKPGGP--ENLYVKEVA-KPSPGEGEVLLKVAASALNRADLMQRQG----QYDPPPGASNILGLEASGHVAELGPGHWKIGDTAMALLGGQAQYVTVPEGLLMPIPEGLTLTQAA----AIPEAWLTAFQLLHLVGNVQAGDYV--LIHAGLSGVGTAAIQLTRMAGAIPLV--TAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQ----RLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL...... 330
325  5.000e-43 18  Bos taurus gi|27806685||ref|NP_776450.1| crystallin, zeta (quinone reductase) [Bos taurus] protmod 5 ...QKLMRAIRVFEFGGP--EVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHNIKPLLPYTPGFDV--AGIIEAVGESVSAFKKGDRVFTISGGYAEYALAADHTVYTLPEKLDFKQGA----AIGIPYFTAYRALLYSAPVKPG--ESVLVHGASGGVGIAACQIARAYGLK--VLGTASTEEGQKIVLENGAHKVFNHKEANYIDKIKKSVGEGVDVIIEMLANVNLSNDLNLLSHGGRVIVVGSRGTIEINPRDTMTKESSIKGVTLFSST----------KEEFQQFAAALQAGMEIGWLRPVIGPQYLLEKATQAHEIIHSSGATGKMILLLD..... 330
326  6.000e-43 16  Pseudomonas putida KT2440 gi|26989707||ref|NP_745132.1| alcohol dehydrogenase, zinc-containing [Pseudomona protmod 2 .MNSRIMQALTFKRYG--KSPDIGLADVP-RPTPKADELLVQVHAAGLNPIDNMIPTGMFKPVLHFQLPATLGSDLAGIVTEVGSNVTRFKPGDAVFASLGAIAEFAVVPESAAALKPANLSFEQAA----SIPMVGLTSWQALKERLKLQAGQKV--FIPAGSGGIGTFAIQLAKHLGAK--VGTTTSTGNV-DLVRALGADEVVDYKTQDFETVLRD-----YDAVLGTVRGDAIEKSLSILRPGSQIVLVGPLDAAFARAKRLNLLLTFVFGLMSRKRLAKRRNVQYSFLFVQPDGLAEIGKLLDAQQIQPVIDRVFPFEDAKGALEYLAQGRSKGKVVIKM...... 338
327  7.000e-43 19  Deinococcus radiodurans R1 gi|6458792||gb|AAF10634.1| NADPH quinone oxidoreductase, putative [Deinococcus r protmod 74 ..................TPDVMELREVP-RPAPRAGQVLLRVEAVGVNFADALSVGGQYLTATKVPYVPGMELAGTVV--ELGEGVTNVQVGQRVAALTGGLAEYAAVPAAGVVPVPESFTPAQAAAF----PVSFMTAYHALKTLGRGEAG--EWVLVQAAAGALGTASVQLAKALGM--NVIALASTEEKLQLARNLGADVTILQDDPDRVQKVRDAAGGGVPLLLEVVGGSRFDESLKMVAPLGRIIFIGNASREEVSMNPAALMKRNVSVIGLWLTSLMLDAEVSAAASQG------LAPLIASGKVVPQVGPSYGLADSSRAFQDILDRKTTGKVVI........ 384
328  7.000e-43 18  Bordetella pertussis Tohama I gi|33591950||ref|NP_879594.1| probable Zinc-binding dehydrogenase [Bordetella pe protmod 7 ..............HGHGGPEVLQYDTAFPDPKAGEGDVILRVKATSINYHDVFTRRGMPGIKLDFPVIMGLDVAGEIV--EVGPGVQGWKAGDRVLTVHGGLAELCKAREHQLIRIPDGVSYEQAA----ALPVAFGTAYRMMHTIGQVQAG--EKVLVLGASGGVGVGCVMLAKIAGAQ--VIACASSEAKMQRLRELGADHVINYADTDFAKAIYELYGGGVDVAVNFTGGDTWVKSMRCLRRGGRLLTCGATAGYDPQTDL--------------RFIWTFELNIRGSNGWMREDLDALLGLVQSGKMQVPIDRVLSLQDAGEALRLIEDREVMGKVVVT....... 334
329  7.000e-43 20  Bradyrhizobium japonicum USDA 110 gi|27379694||ref|NP_771223.1| quinone oxidoreductase [Bradyrhizobium japonicum U protmod 4 ........AVRVHKVGGPEALVYESVEV---PAPGPGEVRIRQHAVGLNVYYRTGLYKAPELPFIAGN------EASGEVIAVGPGVTNFHPGDRVAYYHGAYTGERNIPWEKLVKLPDHITHEQGA----VLMLKGLTVWYLLHKTFKVEP--HHRVLIHAAAGGIGLLACQWARALGA-HVIGTVGSREKA-ELAEANGCDHVILYNEEDFVARVKQIRNEGCDVVYDGVGKATFPGSLSCLKPRGMFVSFGNASG-----PVPPFSIAELNNHGSLFATRPKLNDYVGTRKELLEGADTLFSAVINGKLHVPINHAYALKDAAKAHIDLESRKTTGASILK....... 323
330  7.000e-43 19  Methanosarcina barkeri str. fusaro gi|48840494||ref|ZP_00297421.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 ......MKAIRIHDFGEP--DVLKYEDIPES-QPGPGEVRIRAIAAGVNPI------DWKIRRGYMELPLPMTMGSDVAGVVIGQGVDSFQPEDEVFGGQGGYAEYIVVNSTQIAQKPKSIGFIESA----AIPTAGLAAWQSLFDIAGLEKG--QSVLIHGASGGVGTFAVQFAKWKGAY-VIGTASSKNA--EFLKSIGCDEVIDYRNQQFEEIVSNL-----DVVLDTIGGDTFERSWGVLKPGGFLV---------TTVASIPEGTPQKHGVRAERLITQ----------ADGKELAQIAAIIDERKIKPIVTTVLPLADAQKAHEMSESGHTRGKIVLRIAED... 306
331  8.000e-43 16  Polaromonas sp. JS666 gi|54029246||ref|ZP_00361388.1| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ......TLAVQIDQNGGP--EQLKLVDVTVGEP-GPGEIRIRHKAVGLNFIDVYQRTGL----YKLPMPLQLGMEASGVVEAVGEGVTHLKAGDRAAYAPGSYCELRVMPAKCVCRLPDAISFETGA----AMMLKGLTVQYLLRRTGGLNAGDFV--LFHAAAGGVGLIACQWAKAMGL-QLIGTAGSDE-KCALAKANGAAFVINYAKEDFVARVKEITGGGVKAVYDSVGKDTFLKSLDCLRPFGLLANFGNASGKVEPLDIGVLAAKGSLYV-----SRPTLFTHIATRETTQEMADDLFAMVTGGKIRIAIDQRFPLADVAEAHRSLEARKTTGCTILTL...... 327
332  8.000e-43 20  Silicibacter pomeroyi DSS-3 gi|56679535||gb|AAV96201.1| oxidoreductase, zinc-binding dehydrogenase family [S protmod 19 .............................PVPEPAPGQVRIDIRACGLNFADLLMQKGTYQDTPPAPFTLGMEVAGTI--NALGTGVSHLKVGDRIATGQGGLAEQGVFDADRALPLPDTMSFEHAAAFQIAYG----TSHMALDHRARLQPG--ETLLVTGAAGGVGLTAVEIGKLMGA-RVIAQARGADKL-EIARQAGADILIDA-DEDLRARLLDL--GGVDVVYDAIGGDVFKAAFRAANPEARLLPIGFAGGEVPQIPAN---------HLLVRNLTVIGFYIGGYLSFRPEVIRNSFQWYQQGRLHPHVSHILPLERAAEGLELLRNRTATGKVVIT....... 317
333  1.000e-42 20  Tetraodon nigroviridis gi|47197307||emb|CAF87970.1| unnamed protein product [Tetraodon nigroviridis] protmod 12 ...................PENLYLKSVP-RPQPKVGEALVKIHATALNRADLLQRRGL----YPPPPGESDIMGLEVAGTVAALGPKGWKLGDRVMALLGGYAEYVAVPEELLMPVPPNLSLCQAA----AIPEVWLTAFQLLAFIAQVQPG--EVVLAHAGASGVGTAAVQLVRLFGA-VPVVTAGSPEKLK-MAENLGAAAGFNYREGSFAQRVHDFTGGGVNIILDCIGGHIWEQNVSCLATDGRWVLYGTIGGRAVE----GNLLGNLLSKRGHLLSSLLRSRSLQYKAELVTAFSHKVLPHFSGSLRPVIDSTFNLENIADAHRHMEANRNTGKIVINV...... 326
334  1.000e-42 18  Bordetella bronchiseptica RB50 gi|33599331||ref|NP_886891.1| probable Zinc-binding dehydrogenase [Bordetella br protmod 7 ..............HGHGGPEVLQYDTAFPDPKAGEGDVILRVKATSINYHDVFTRRGMPGIKLDFPVIMGLDVAGEIV--EVGPGVQGWKAGDRVLTVHGGLAELCKAREHQLIRIPDGVSYEQAA----ALPVAFGTAYRMMNTIGQVQAG--EKVLVLGASGGVGVGCVMLAKIAGAQ--VIACASSEAKMQRLRELGADHVINYADTDFAKAIYELYGGGVDVAVNFTGGDTWVKSMRCLRRGGRLLTCGATAGYDPQTDL--------------RFIWTFELNIRGSNGWMREDLDALLGLVQSGKMQVPIDRVLSLQDAGEALRLIEDREVMGKVVVT....... 334
335  1.000e-42 19  Pseudomonas syringae pv. tomato str. DC3000 gi|28850647||gb|AAO53727.1| quinone oxidoreductase [Pseudomonas syringae pv. tom protmod 2 ........AKRIQFSTVGGPEVLEYVDFE-PEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPS---GLGAEGAGVVEAVGDEVTRFKVGDRVAGPLGAYSEVHVLPEANLVKLADSVSFEQAA----ALMLKGLTVQYLLRQTYQVKPG--EIILFHAAAGGVGSLACQWAKALGA-KLIGTVSSPEKA-AHAKALGAWETIDYSHEDVAKRVLELTDGKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVT-----RPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTIL........ 323
336  1.000e-42 31  Aspergillus nidulans FGSC A4 gi|40742261||gb|EAA61451.1| hypothetical protein AN7199.2 [Aspergillus nidulans protmod 5 ...KQWILANKPTTLSGPTP-TFKL-TSADVPKPSSSQALVKTLMLSNDPAQRTWPNADPERLYLPPVQEGSPMSAFALAEVVESGSPNLPVGSLVL-CPTNWTEYSVHEIKTLQKIQP-IEGLDLGHFLGALGMTAVTAYYGIKEVAGTTKDD--TVVVSGAAGATGSMVVQIAKIIGCKRVIGIAGT-DDKCRWVETLGADVCINYKKDSFEQDLIKETEGFVEVYFDNVGGNILDLMLTRMKRHGRIAACADDKQE-----------------VISMRLHIRGFIVLDYYHKFSDVIAELTQAWKEGKIVVDESVEAKFEDIPNVWMKLFEGGNTGKLCTKI...... 333
337  1.000e-42 22  Thermus thermophilus HB8 gi|55980122||ref|YP_143419.1| NADPH:quinone reductase [Thermus thermophilus HB8] protmod 1 ......MRAIRVHEVGGP--EVLRLEELPVPEP-GPGEVLVRLLAIGVNFI------DTYKRKGLYPVPAPFTLGEEGAVEKVGEGVVGVRPGDRVAFANGAYAEYLVVPAERLVPVPEGLDPKLAAAAL----LQGMTVHYLLKSTYPVAPGDQV--LVHAGAGGVGQLLIQWAKRLGAT--VYATASTEEKRGLCLQAGADYALPY--EGFAEAVKALSGGGVDVVYDGVGKDTFLGSLAALRPRGMLVLFGQSSG-----PVPPQDPQILNRMGSLFLTRPTLHHYTASRKELLFRAGEVFRGVLEGWLKVRIGAEFPLENAREAHEALEGRRTTGKVLL........ 317
338  2.000e-42 18  Silicibacter pomeroyi DSS-3 gi|56678579||gb|AAV95245.1| oxidoreductase, zinc-binding dehydrogenase family [S protmod 11 ..................GPETLELTEMAD-PAPGKGELLVRVHAAGVNFPDTLMIRDLYQMKPPRPFAPGGEIAGEVLA--VGEGVSGYTPGDRVLALFGGFATHLTVKANVAVKIPDAMPYDEAACF----IFTYGTSHHALKDRAALQPG--ETLLILGAAGGVGAAAIELGKAAGA-RVIAAVSSQEKA-EFCRQIGADETLVYPREALSGEIKKLAGGGVDVVYDAVGGAYAEPCLRAMAWQGRYLVVGFPAG-IPSIPLNLTLLKGCQIVGVFWGAS-----VFRDPKGHAANVGDLFRLYAEGRIKPQICARFPLDQAGAALEMMQDRKVLGKVVIT....... 329
339  2.000e-42 15  Streptomyces coelicolor A3(2) gi|5457258||emb|CAB46946.1| putative quinone oxidoreductase [Streptomyces coelic protmod 11 ..................GPEALVWAEVPD-PQPGEGEVLVEVAASAVNRADIMQRQGFYDPP--PGASPYPGLECSGRVAEVGPGVSGWSVGDEVCALLGGYAEKVVVPAGQLLPVPQGLDVKRAA----ALPEVVCTVWSNVFMVAHLRPG--ETLLVHGGSSGIGTMAIQLAKAVGAK--VAVTAGTKEKLERCAELGADILINYREQDFVAEVKDATGGGADVILDNMGAKYLDRNVQALAVNGRLAIIGMQGGRKGELNIGTLLAKRAAVSATSLRAR----PLEEKAAIVAAVKEHVWPLLAGGHVRPVVDREMPMSEAAEGHRVVEESGHIGKVLL........ 323
340  2.000e-42 18  Lama guanicoe gi|507275||gb|AAA99986.1| NADPH:quinone oxidoreductase/zeta crystallin gi|609386 protmod 5 ...QRLMRAIRVSEFGGP--EVLKLQSDVAVPIPEEHQVLIKVQACGVNPVDTYIRSGTYSRKPRLPYTPGLDVAGLI--EAVGERVSAFKKGDRVFTVSGGYAEYALAADHTVYKLPGELDFQKGA----AIGVPYFTAYRALLHSACAKAG--ESVLVHGASGGVGLAACQIARAC-CFKVLGTAGTEEGQR-VVLQNGAHEVFNHREDNIDKIKKSVGEKGIDVIIEMLANVNLSNDLNLLSQGGRVIIVG--SKGPVEINPRDTMTKESSIKGVTLF--------SSTKEEFQQFAAALQAGMEIGWLRPVIGSQYPLEKVAQAHEDTHSSGAAGKVVL........ 327
341  2.000e-42 17  Bordetella parapertussis 12822 gi|33595051||ref|NP_882694.1| probable Zinc-binding dehydrogenase [Bordetella pa protmod 7 ..............HGHGGPEVLQYDTAFPDPKAGEGDVILRVKATSINYHDVFTRRGMPGIKLDFPVIMGLDVAGEIV--EVGPGVQGWKAGDRVLTVHGGLAELCKAREHQLIRIPDGVSYEQAA----ALPVAFGTAYRMMNTIGQVQAG--EKVLVLGASGGVGVGCVMLAKIAGAQ--VIACASSEAKMQRLRELGADHVINYADTDFAKAIYELYGGGVDVAVNFTGGNTWVKSMRCLRRGGRLLTCGATAGYDPQTDL--------------RFIWTFELNIRGSNGWMREDLDALLGLVQSGKMQVPIDRVLSLQDAGEALRLIEDREVMGKVVVT....... 334
342  2.000e-42 20  Burkholderia cepacia R1808 gi|46319862||ref|ZP_00220260.1| COG0604: NADPH:quinone reductase and related Zn- protmod 4 ........AIRYDQPGGP--EVMKWVDVEVGEP-KAGEVRIRQHAVGLNYIDVYFRTGL----YPQPLPGGLGMEAAGEVTAVGDGVSALKAGDRVAYVPGAYAQERVMPAERLVKLPDALGYDDAA----SVMLQGLTAHYLLRRTYPVKAGD--TILIHAAAGGVGLLVCQWAKALGAT-VIGTVGSDEKA-ALASAHGCDHPIVYTRENFTQRVKEITNGGVPVVYDSIGKDTYIGSLDCLAPLGYFVSFGNASG-----PLPPIDSKDFSSRGSLFFTRPTLFSYIAKRADLEAAAAELFDVILSGKVKTSINQRYPLAEVGRAHADLESRKTTGSTVL........ 322
343  2.000e-42 15  Corynebacterium diphtheriae NCTC 13129 gi|38232802||ref|NP_938569.1| Putative quinone oxidoreductase [Corynebacterium d protmod 14 .........................VHDAPTPTLQPGEVLVQVKAAGVNRADLLQ----AAGHYPPPPGESEIIGLECAGVIVDAGTTSRNVGDKVACLLGGYAEYVAVPEGQLMPIPEGYSF----AEAAAVVEVAATVWSNIGMLTGLKP--EHMFLIHGGAGGIGTFAIQLAKHVGAT--VAVTAGSKEKLETCRELGADILINYREEDFAEVLKNKC----DRILDIMGAKYLDQNVRALAMDGHQVTIGMQGGVKGELNIGRLLSKRGTISATALRARDRE----DKARIVASTVENVWPLLADGTIRHHIHATLPLEQAQRAHEMLKNGEVTGKLVLEV...... 315
344  2.000e-42 22  Thermus thermophilus HB27 gi|46200135||ref|YP_005802.1| quinone oxidoreductase [Thermus thermophilus HB27] protmod 1 ......MRAIRVHEVGGP--EVLRLEELPVPEP-GPGEVLVRLLAIGVNFI------DTYKRKGLYPVPTPFTLGEEGAVEKVGEGVVGVRPGDRVAFANGAYAEYLVVPAERLVPVPEGLDPKLAAAAL----LQGMTVHYLLKSTYPVAPGDQV--LVHAGAGGVGQLLIQWAKRLGAT--VYATASTEEKRGLCLQAGADYALPY--EGFAEAVKALSGGGVDVVYDGVGKDTFLGSLAALRPRGMLVLFGQSSG-----PVPPQDPQILNRMGSLFLTRPTLHHYTASRKELLFRAGEVFRGVLEGWLKVRIGAEFPLEKAREAHEALEGRRTTGKVLL........ 317
345  3.000e-42 31  Arabidopsis thaliana gi|25404554||pir||E96680 hypothetical protein F5I14.9 [imported] - Arabidopsis t protmod 156 ...................................................................VILMQRIEGFGLARVIDSDDTNYKPGDIVSGII-GWEEYSLLSSDNLQLRNIQLDDDPLSYHLGLLGMAGFTAYAGFNEICCPKKGDSV--FVSAACGAVGQLVGQLAKLHGCY-VVGSAGSKQKVEILKNELGYDEAFNYKEEDLDTALKRYFPEGIDIYFDNVGGSMLDAALLNMKVRGRIALCGMVSLQSLSTSSQGIK---NLYSAIYKRLRLEGFLQSDYLHIFPQFLENVKRYYKEGKIVYVEDISEGLDLAPAALVGLFSGKNIGKQVVRVAKE... 432
346  3.000e-42 21  Ralstonia eutropha JMP134 gi|45515495||ref|ZP_00167050.1| COG0604: NADPH:quinone reductase and related Zn- protmod 13 ...................PDSLTVETLPD-PVPDQGEVVIEVKAAGVNFPDVLIIQNKYQAKPELPFTPGSEL--AGIVTAVGAGVTHVKPGDNVIAYNGAFASHVKAPANKVVPMPPGVDYETAAAFTLTYG----TSHHAVVDRGELKAG--QTMLVLGAAGGVGLAAIEIGKAIGA--RVIAAASTDEKLAVCKEHGADALINYSTEDLRERVKALTDGGPDVIYDPVGGVYAEPAFRSIAWRGRYLVVGFANGEIPKIPLNLALLKGASLVGVFW-----GDFVRREPRANQANMAQMLGWMKEGKLRPHISARYPLEQAPQALKDMEARKVTGKVVI........ 323
347  3.000e-42 19  Saccharopolyspora erythraea gi|37595057||gb|AAQ94248.1| type I PKS [Saccharopolyspora erythraea] protmod 1336 .LARRAVLPARLDVTAEGTLENLALVPAPEAQPLEPGQVRIAVRAAGVN--------FRDVLIGLGMYPGEVQLGGEGAGVVVAPDVTGLAPGDRVTGLFGGFGPVAIADHRTVARIPRDWSYEQAA----AVPIAYLTAYLGLVELGALRAG--ESVLVHSAAGGVGTAAVQLARHLGA-HVFGTASPGKWDAVRAQGVAEENLASSRTLDFERHFLAATGGGVDVVLNSLAGEHVDASLRLLPRGGRFLEMGKTDIRGAD-----------EVAAAHPGVAYEAFDLMRPPERVRVMLAEVLELFERGALSLPPITSWPVSRAPEAFRHLSQARHTGKVVLTV......1664
348  4.000e-42 18  Arabidopsis thaliana gi|21618282||gb|AAM67332.1| quinone oxidoreductase-like protein [Arabidopsis tha protmod 6 ..........RVYEHGGP--EVLKWEDVEVGEP-KEGEIRVKNKAIGLNVYFRKGVYKPASMPFTPG------MEAVGEVVAVGSGLTGRMIGDLVAYAMGAYAEEQILPADKVVPVPSSIDPIVAA----SIMLKGMTAQFLLRRCFKVEPG--HTILVHAAAGGVGSLLCQWANALGAT--VIGTVSTNEKAAQAKEDGCHHVIMYKNEDFVSRVNDITSGGVNVVYDSVGKDTFKGSLACLKSRGYMVSFGQSSGSPDPIPLSDLAPKSLFLT------RPSMMHYNETRDELLECAGEVFANVTSGILKARVNHKYPLSRVADAHADLENRITSGSVVL........ 322
349  4.000e-42 18  Oryza sativa (japonica cultivar-group) gi|15451578||gb|AAK98702.1| Putative quinone oxidoreductase [Oryza sativa] protmod 2 ...RAVVIAR------AGGPEVLEERDVGELPPPGEGEVLVGVSAAGVNRADTVQRQGRY--PAPPGASPYPGLECSGTILALGPNVPRWAVGDQVCALLGGYAEKVVVPAGQLLPVPEGVSLTDAAG----LPEVACTVWSTVFVTSHLSP--SESFLIHGGSSGIGTFAIQIAKHLGIK--VFVTAGSEEKLAACKGLGADVCINYKTEDFVARVKEETNGGVDVILDNIGGLYLQRNLNSLAVDGRLFIIGFQGGAVTEVNLQPMLARRLTIQLRNRSLDNKALIVSEVEKNV-------WPAVVQGKVKPVIYKTFPLSEAAEAHKLMEESSHIGKILL........ 336
350  4.000e-42 19  Bradyrhizobium japonicum USDA 110 gi|27380853||ref|NP_772382.1| putative quinone oxidoreductase (EC 1.6.5.5) [Brad protmod 11 ..................GPADLRLSEIDEPRPAGD-EILIDVHAASVSFMDQLMVSGLYQMRPPTPFVPGT--EASGIVVAVGDKVTAFAPGDRVASWTGGYAERMTAKESKSVRLPDGVAFEAAATVLHNYG----TAYYALVERARAQAG--ETVFITGAAGGVGLAAVDLGRHFGL--RVVAGVGSDDKAALVRGYGASEIVNYRSEDLRDRIKSITSGGIDVGFDNVGGAVFEQMARLMKWGGRLLPIGFASGEIPQVPMNLPLLKNYSIIGVFVGAWAERFS-----AEAAQMNDTLMQLLADGQIRPHIDCVLPLEEAGDGMRAVANRTVQGRIVLKI...... 324
351  5.000e-42 17  Magnetospirillum magnetotacticum MS-1 gi|23014290||ref|ZP_00054113.1| COG0604: NADPH:quinone reductase and related Zn- protmod 16 ..................GPEVLVPITRPL-PQPKPGEVLIKVAAAGINRPDVLQRAGAYPAPPGASDLPGLEVAGTIVA--LGEGVTSPALGAEVCALGGGYAQYCTVDARHCLPIPKGYDMIRAA----ALPETFFTVWHNVVERGQLKSGDR--FLVHGGAGGIGTTAIQLAKALGAT--VFATANGEAKCTACRELGADMAIDYSTADFVEVIRAETKGGIDVILDMVGGDYMARNIKSLAADGRLVSIAFLRGSSAELNMMPVMLKRLTLTGSTLR-----PQSNDAKARMARGLAEIWPLLDKGAIAPLIHAVFPLAEAAKAHALMESNAHMGKIVLQV...... 330
352  5.000e-42 21  Chromobacterium violaceum ATCC 12472 gi|34330257||gb|AAQ57892.2| quinone oxidoreductase [Chromobacterium violaceum AT protmod 1 .MSQAIVFA----ETGGP--EVLRLQSAEVG-QPGPGQARVRHTAIGVNFIDTYQRSGL----YPTPLPSGLGSEAAGVVEAVGEGVAGLRPGDRVAGPLGAYSTERLIAAEHLVKLPDGIADETAA----CAMLQGMTVEYLVQRTFPVQPG--QTVLWHAAAGGVGQIALQWLSAMGV-QVIATVGSQAKA-EIARSLGAAHVILYREEDVAARVREITGGGVPVVFDSVGKDTFESSLDSLAPRGMMITFGNASG-----PVPALSPLELTKRGSLFLTRPKLGDYIASRTDLEASSAALFSRLRDGTIKLSPSHRYPLAEAAQAHRDLEARRTTGSIILQ....... 323
353  5.000e-42 21  Magnaporthe grisea 70-15 gi|38102214||gb|EAA49080.1| hypothetical protein MG00738.4 [Magnaporthe grisea 7 protmod 13 ...............GAGPASALFINAETPRPTPGAGQVLVKVSAFGLNRMDLLQREGKYPLPPQAPKTLGVEFSGESLGDFSASASTDFKKGDAVFGLAYGYAEYIAVSARMLMHKPAGLTHEQAAG----IPETFITATQALHLVGGFAKGDRV--LWHAGASGVSIAGAQLARRAGAGAVFSTAGSDDKCAFLREELGVDGAFNYKTQDWAEEVRRATGGGVDLIVDFVGADYFSKNMDAAAQEGRIVCLGLLSGAVVK--------EVNVAQLLFKRLRIEGSTLREYQGMLRDRLEECLPQFETGELKVFVDKVLSWEQIQEAHELLEKNVTRGKIICTI...... 342
354  5.000e-42 16  Schizosaccharomyces pombe gi|3850084||emb|CAA21911.1| SPBC1773.06c [Schizosaccharomyces pombe] gi|19111913 protmod 15 ....................DQLKPEEYEVPQKLNPGEVLVKLKAASLNYRDLIITKGLYPLPLQLPVVPGS--DGAGIIEKVGEDVEGFEKGDSVVCNFGCFQKYAVLPAHALVHAPKNLSFEEIATLPCAA----VTAWNGLFGSHQVKPGNN---VLVLGTGGVSTFALQFALAAGA--NVTVTSSSDEKLEFAKKLGATHTINYKTPQWASPALKMTNGGYHHVIEVGGEKTLPQSIACLAKDGMISMIGFVASEGTT-----PNLTSIIGQILNRNANIRGIFVGSV-----SMFRDMVACIEAKDIHPVVDKVFPFDQLKEAYEYQWSQAHIGKVVLKID..... 346
355  6.000e-42 19  Caulobacter crescentus CB15 gi|16127989||ref|NP_422553.1| quinone oxidoreductase [Caulobacter crescentus CB1 protmod 1 ......MLAVQAVRTGGP--EVLEVVDLPL-PSPGPGQILVRHQAVGLNYI------DTYHRSGLYPVKTPLVIGLEAAGVVVGEAVTRFKVGDRVAGTMGAYAQAAVVPAERAVLVPDGVSLEVAAAAL----LKGMTAEFLVRRCFHVKQGD--WVLVHAAAGGVGQILVQWCKALGAT--VVATVGSTAKATIARDLGADHVIDYSHEDVAARVAELTGGGVAVVYDGVGKDTWEASLASLARRGMLVTFGNASGPAPAFPPLALAPKSAFVT------RPKLFDYIVTTEELDESAQALFAVIASGAIKIDIGQTFPLAEARAAHEALEGRRTTGATLL........ 319
356  6.000e-42 18  Legionella pneumophila str. Paris gi|54297646||ref|YP_124015.1| hypothetical protein lpp1697 [Legionella pneumophi protmod 24 ..........................ELTLVEGPNPGQILVRVKATALNRADLMQKYGK----YPPPPGESDIPGLEVAGEVIGSKVKQFKPGDKIYGLVGGYAEICPVDASLAHHIPSHWNYSLAA----ALPEALTTVYATLYDLGALSAG--QTLLIHGAGSGIASLAIQMAKLT--TTKVITTVGDSSKIEKALALGADQVIHYKEQDFELLIED---NSVDLIIDFVGGDYFNKHLHLLKPQGKLIQIACLKGSKVECSLALLMQKRLHIIGFVLR----SQSIKEKARLWKLAHDHWFNAFENDKIKPVIDSEFDLNQIETALQRMQQGSHFGKIVIRVG..... 332
357  6.000e-42 18  Oceanobacillus iheyensis HTE831 gi|23098273||ref|NP_691739.1| zinc-binding oxidoreductase [Oceanobacillus iheyen protmod 14 .......................ELHEQDVPPTINDNQILIEQYATSINPIDWKLREGYLKDGFNFEFPIILGWDSAGVVAEVGKNVSQFKVGDRVFSRQGTYAEFVAVEESRVAKIPENVSFEEAA----SVPLAGLTAWQCLVDFSAIKKGDKV--LIHAGSGGVGSFAIQFAKHFGA--YVATTASGKNESL-VKELGADRFINYKEENFNEVLED-----YDIVVDTLGGDILEQSFEVLKEGGKLVSI---AGNPDEE------------KAKEKGIKAGFL----WLEENGKQLSEVADLLENGKVKSVIGHTFPLTELREAHQLSETHHARGKIVIKI...... 310
358  6.000e-42 19  Burkholderia cepacia R18194 gi|46311355||ref|ZP_00211963.1| COG0604: NADPH:quinone reductase and related Zn- protmod 8 .............EFGAP--DVLKLAERP-RPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDLPGLEVAGEIVGGDLSDNPFGLKLGDRVCALLGGYAEYAVAPLPQCLPVPDGLTDIEAA----SLPETFFTVWSNVFDRAQLGAGEGETLLVQGGSSGIGVTAIQIAHALG-FRVFATAGTADKCRA-CEALGAERAINYKTEDFVEVVKSLTHDGVDVILDMVAGSYVPRELSALVDGGRLVLIALLGGAKADVNLGEILRRRLTITGSTLRPRPVEF----KAQIAAQLKSRVWPLLADGRIKPVIYRVLPAADAAQAHALMESSEHTGKIVL........ 333
359  8.000e-42 17  Xenopus laevis gi|50414532||gb|AAH77203.1| LOC445846 protein [Xenopus laevis] protmod 13 ....RVMRAIRVFEFG--KADVLKLCTDLPLPSPVENQVLIRVHACGINPVETYIRAGTYARKPTLPYTPGTDV--AGVIESVGNDVTSFKRGDRVFAITGGYAEYTIASADTVYPLPDVLSFKQGA----AIAVPYFTAYRALFSKANGRPG--EVVLVHGASGGVGIAACQIARAYG-FQVFGTATPEGLNYAL--KNGAHKVFNHKEKDYIDKIQDATGGGVNIILEMLSNVNLSYDLKLLSAGGRVIIIGCRG--PIEINPRDTMAKETSIIGVSLF--------SATKEDRMETAAALFGGMEAGWLKPLIGPEYPLEKASQAHEDIIQNGATGKMVFVI...... 335
360  8.000e-42 15  Gibberella moniliformis gi|40806905||gb|AAR92212.1| polyketide synthase [Gibberella moniliformis] protmod 1913 ....................DSLQFQDDELEKPLGPYDVEVRVHATGLN---------LLDVMIALGKVIGEAFGQECAGVVVGTDVDRVSVGDRVCGLLGTFKTFARGSQWQFAKIPSSID----YAVAAAVPVVYTTAYYGLHDLARLQAG--ESILIHWGAGGVGQAAIQLAKAVGA-EVFVTVGSIEKRDFLHEHYGIHHVLSSRDLSFVHGIKRLTDGGVDVILNSTAGQTLRASWDCIAPYGRFIEIGKVDIFANAGLPMGPFKKSVTF-----SFFDIGLISLERGRLFSRVLQDVVDLLAKGSITPPPLHVYSYSDIQEAFRIMQSGSHMGKLVLKAQDDD..2228
361  9.000e-42 16  Geobacter sulfurreducens PCA gi|39997731||ref|NP_953682.1| alcohol dehydrogenase, zinc-containing [Geobacter protmod 7 ..............DGFGGLDVLKVGE-AERPKPAEGQVLVKVVATSVNRPDLVQREGK----YPPPPGDSEILGLEVSGTIEEPGVTGWQVGDRVMSLVGGYAEYAVAYASHLMRIPESMSFEEAA----CVCESYITAFLNVFMIGGLK--DNNSVILHGGGGGVNTAGIQLCKALVPNTKI-VATAHPSKIDRVKALGADLVVDFTTPDFSEAVKEFNKKGVDVILDHVGAKYLAPNMNSLAYAGRLVIIGVISGIKAELNLALMMVKRQQIIGSVLRSR----PVKDKGEIVAEFTRTALPKFADRTIVPIIEKVFPMDQVVEAHRMMEEDKHFGKIVLKIS..... 328
362  9.000e-42 20  Ralstonia metallidurans CH34 gi|48772516||ref|ZP_00276858.1| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ............YETGGP--EVLRYEDMEVGDP-GPGQVRIRHVAVGLNYADTYFRNG----TYPVPLPAGMGVEASGVVQAIGPDVTNVAVGDRVTYTLGAYSTERLVPAAPLIRLPENIGFETAA----AMTMRGLTSAYLMRRIYAFKRGD--TILLHAAAGGVGLIVSQWAKLQGL--NVIGTVSSEAKAEVARAHGCDHIINYSHEDVAKRVRELTDGGATVVFDSVGKNTFMASLDSLKRRGLLVCVGTASG-----PIPPFDPVLLAMKGSVYVTRPALADYIADPGEKAELAGELFDHVGAGRIRIEINQRYALEDAVQAHRDLESRKTTGSSIFVV...... 320
363  1.000e-41 18  Crocosphaera watsonii WH 8501 gi|53736155||ref|ZP_00179020.2| COG3321: Polyketide synthase modules and related protmod 525 ..................TLSNLELVPTSRI-SPEQGEVEIKVGATGLNFI-----DVLDGLGLLPFEREWFGVECVGEVVRVGEGVNELKKGDRVLALPGSFSQYVTITTQLVSHCPKNLTIEEAAT----IPANFLTAYYALHRLGKIKKGDR--ILIHSAAGGTGMAALQIAQQVGAE---VFATASPNKWEFLKSLGVKNVMNSRTLDFAAEILTITEGGVDVVFNSLSGEFITKSFSVLADEGRFLEIGKRDIWTREQVHKVKPNASYFAIDLLT-------IAQQQPQLIQSMLTELKQKFEEDRLKPLPRNVFPIEQTIQAFRYMQKGKHIGKIVVSYNPE... 834
364  1.000e-41 20  Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 gi|45656846||ref|YP_000932.1| alcohol dehydrogenase [Leptospira interrogans sero protmod 13 ....................ENLKISERPDPVPVQ-GEVLVRFRAASLNY----RDYLMAIGRYNPKQKLPLIPLSDGAGEVVGPGVTRWKIGDKVCALDGTLCEYRIFREEGLVLMPENLSFAEASTLPCAA----LTAYTAIVTHGNIQPGAT---VVVQGTGGVSIFALQFAKMMGC-RVIATSSSEEKL-AKVKELGADEVINYNETNWDREVRKITMKGADLVIEVGGAGTLQKSISSTKPWGTIALIGVLAGGESNNLSLFPILMQ--------GIRIQGIIVGSKRN-----FEDMNLAINTNKIKPVVDQVYSFEEVPKAFESLKAGKHFGKICIEI...... 337
365  1.000e-41 18  Rattus norvegicus gi|34860973||ref|XP_342364.1| similar to crystallin, zeta [Rattus norvegicus] protmod 5 ...QKLMRAIRVFEFGGP--EVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDV--AGIIESVGDGVSAFKKGDRVFCFSGGYAEFALSADNTTYPLPETLDFRQGA----ALGIPYFTACRALFHSARARAG--ESVLVHGASGGVGLATCQIARAHGL-KVLGTAGSEEGKKLVL-QNGAHEVFNHKEANYIDKIKSAGDKGVDVIIEMLANKNLSNDLKLLSCGGRVIVVGCRGSI--EINPRDTMAKETSIIGVSLFSST--------KEEFQQFAGILQAGIEKGWVKPVIGSEYPLEKAAQAHEDHSSGK-MGKMIL........ 348
366  1.000e-41 17  Legionella pneumophila str. Lens gi|54294620||ref|YP_127035.1| hypothetical protein lpl1696 [Legionella pneumophi protmod 24 ..........................ELTLVEGPNPGQILVRVKATALNRADLMQKYGKYPPPPGESDIPGLEIAGEVI--VTGSKVKQFKPGDKIYGLVGGYAEVCPVDASLAHHIPSHWSYSLAA----ALPEALTTVYATLYDLGALSSG--QTLLIHGAGSGIASLAIQMAKLT--NTKVITTVGDSSKIEKALALGADQVIHYKEQDFELLIED---NSVDLIIDFVGGDYFNKHLHLLKPQGKLIQIACLKGSKVECSLALLMQKRLHIIGFVLR----SQSIKEKARLWKLAHDHWFNAFENDKIKPVIDSEFDLNQIETALQRMQQGSHFGKIVIRVS..... 332
367  1.000e-41 15  Sinorhizobium meliloti 1021 gi|15964706||ref|NP_385059.1| PUTATIVE OXIDOREDUCTASE PROTEIN [Sinorhizobium mel protmod 8 ...............GPGGPENMVLA-RGPLPEVRPGDILIRVEAFGINRPDVLQRKGDYPLPAGASPILG--LEAAGEVVALGEGATGFSTGDKVCALGGAYAEYCAVPATQALRWPKGYDAAKAA----ALPETFFTVWANVFDMARLKSG--ETFLVHGGSSGIGTTAIQLARAFGAE--VFATAGNAAKCEACEALGAKRAINYREEDFKAVVLQETGGGVDVILDMVGGRYFDRNIGSLAKDGRLSIIAFLGGARVD---GANIAPILMKRLQVMGSLLRPRTAAEKQAIRDGLAEKVWPLLEGGDVAPVIQAVLPFAEIAGAHRLMEEGDHIGKIVMRIG..... 327
368  1.000e-41 14  Mycobacterium tuberculosis H37Rv gi|15610913||ref|NP_218294.1| PROBABLE OXIDOREDUCTASE [Mycobacterium tuberculosi protmod 13 ....................DRLVWQEVPDV-SAGPGEVLIKVAASGVNRADVLQ----AAGKYPPPPGVSDIIGLEVSGIVVGPGVTEWSAGQEVCALLGGYAEYVAVPADQVLPIPPSVNLVDSA----ALPEVACTVWSNLVMTAHLRPG--QLVLIHGGASGIGSHAIQVVRALAA--RVAITAGSPEKLELCRDLGAQITINYRDEDFVARLKQETDGGADIILDIMGASYLDRNIDALATDGQLIVIGMQGGVKAELNLGKLLTKRARVIGTTLRARPVSGPHGKAAIAQAVAAS-VWPMIAANRVRPVIGTRLPIQQAAQAHELMLSGKTFGKILLTV...... 328
369  1.000e-41 21  Ashbya gossypii ATCC 10895 gi|44980776||gb|AAS50681.1| ABL090Wp [Ashbya gossypii ATCC 10895] gi|45185140|re protmod 8 ...QKVVLIR---ETGGP--EVLRYEEDYPVPEVRGSDILIKNRYAGVNFI------ETYFRTGLYPCEKPYVLGREAVGVVIGADVRRFKVGDRVACLSGTFAQYTAVSESNVLKLPDDIQDGELQAVAGSLV-NGLTALTLVDEAYKPQVG--EIVLVYAAAGGVGQLLIQLLHAR--SVRVIAVASTDEKLQIAKSRGAEFLINSSREDIVAKVLEFTDGGVGASYDSVGKDTFETTLQSVKRKGTIVSFGNASGAVPPFSIQRLTPKNL------KILRPQLYGYLATREEWEYYSSKLLHLIRSKKLIINITNLSPLEEFKRLTQLLESRQTTGKLLLAIPD.... 334
370  2.000e-41 17  Pseudomonas fluorescens PfO-1 gi|48731787||ref|ZP_00265531.1| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................GPEVLQSRRVPL-PVAAEGEVLIRVHAAGVNPDALQRAGKYPMKPGMNPIPG---LEVAGEVVAIGSGVSTFAVGDRVCALTGGYAEYCTVPAGQTLPIPDGLDWIQAA----AIPETFFTVWANLFGLGGASRG--QRALIHGGTSGIGTTALMLCREFGI-EAFATAGSAD-KCAAIRNLGGD-AINYREQEFAAVIAEKTAQGVNVILDIMGGSYLNGNISALGMDGRLVMLGFLGGARANDIDLLAILGKRAVVTGSLLRARTSAEKAAIADQLR---EHVWPVLAAGRCLPIIDKVYPLAEAAKAHAHMEAGDHIGKIVLKID..... 326
371  2.000e-41 20  Neurospora crassa gi|40882178||emb|CAF06004.1| related to NADPH2 quinone reductase [Neurospora cra protmod 21 ....................DVLKYKTDLPVPEIKEGELLVKNEYIGVNFI------DTYFRTGLYPSASGYPLGKEASGTVVSSKHPRFSPGDRVAYLDAAYAEYTAVSASRCIPLPERISSETAAAAL----LQGLTALTLVREAAGIEQKEGPWALVHAAAGGTGSLLVQILSIMGA-KVIATAGGQE-KCEQAHHHGAHWTIDNKSEDVVERVKEITNGGVDVIFDGVGKATFDADLEMVARKGTVISFGNASGKVEPLDILRLGAKNIKVM------RPVLFGYIVTPEEWERWTTELFELIKTEKVKIKVHEVYPLQEVARAHTDLEGRKTTGKLLLKL...... 336
372  2.000e-41 21  Ustilago maydis 521 gi|46098836||gb|EAK84069.1| hypothetical protein UM03068.1 [Ustilago maydis 521] protmod 14 ..................GPEVVQVRCIPAPTLSGSGQVIVRNEYAGVNMI------DTYHFGGLYPLKCPIVIESAGVVEAVDADVTSVAVGDRVVQYGGGYTEKQLLNAERVIKLPESISTKTAA----AAYLQGLTALTLLKEAHPVKQGD--WILVTAAAGGVGLLLCQMGKAFGA--NVIAVTSTEEKCQLAKQHGAIHALRYNKQDPAQYIAAIKHHGVDAILDGVGADTWESNFEIAARKATIVTFGNASGP------VPAFAPLKLASKNLKVVRPTLFNYVTTREERERYSQELFDLIQQGNVKINVHEEYPFEDMRRAFADIKSRKTTGKLVVKM...... 329
373  2.000e-41 15  Propionibacterium acnes KPA171202 gi|50843635||ref|YP_056862.1| Zn-binding dehydrogenase/oxidoreductase [Propionib protmod 20 .................PGPECIEWTEVPT-PKPGPGEVLVKVKAAGINRGDLLQRQGL----YPPPKGVSETMGLEVTGVILGQDVTGWSEDDEVIALLGGYAEYVIVPAGQLLPIPEGIDPVTAST----LIEVTATVISNMDHVGLAR---GETFLVHGGAGGIGQFAIQYAKSLECT--VITTCGTAEKQEFCRTLGADVALDYHEDWVAGVKDATGGRGADVILDVMGAKYLDLNVDALAIGGRLDIIGMQGGIKGELNIAKLLNKRALVTATSLRPR----PLEEKAKICQRVREVAWPLYTNGSIKPAPVESFPMSEAGRAHERLESGEVLGKVALTL...... 333
374  2.000e-41 21  Ralstonia eutropha JMP134 gi|46132766||ref|ZP_00171434.2| COG0604: NADPH:quinone reductase and related Zn- protmod 6 ........VIRVHEFGPPEAMQL---ERMELPPPAEGEVVVRQTAMGFNFIDIYQRRG----TYPLPPGTGLGHEAAGVVEAVGAGVRGFAPGDRVAYMNGAYADYRNVPAAKLVRVPDSISDEQAA----AVIFKGMTAQYLVRHTHAVKAGDAV--LIHAAAGGVGQILSSWAKALGAY-VIGTAGSPE-KCELARRMGCDVAIDYRSGDWVKAVREATGGGVRVVYDAVGKDTFLGSLDCAQQFGLVVLYGAASGPAPAIEPELLNKKGCLFLT-----RPSVFPHNADPDMFRANAKDLFDAVTAGHVKVEIGARFALQDVAKAHAAAESRATTGAIVL........ 324
375  2.000e-41 20  Dictyostelium discoideum gi|28830193||gb|AAO52644.1| similar to Brucella suis 1330. Quinone oxidoreductas protmod 2 ......MKAIRVSSTGG--VEKMIYESIVKPTITKETDVIIRNHYIGVNFI------DTYHRSGLYKLPLPFTLGREGSGVVEEVGSNKFKVGDRVCYFSPSYADYTLVPEQLVFKLPDSVDFKSGA----AYPLQGMTGHYLVRSTFKLE--SKHTCLIQAGAGGLGQILIQMAKILGAK--VITTVSTPEKEEICKKLGADVIINYNQEELAKLVKQLNDGGVDVVYDGVGASTWKQSLLSLKPLGMLCLIGNASG-----PVPPIDPLLLSTNGSLFLTRPTLAHYIAEKGSMEQRMTEIFSWVEQGKLVLSNPTIIDLERASDAHNLLEGRASKGKILLKPAD.... 330
376  2.000e-41 17  Streptomyces cinnamonensis gi|29122994||gb|AAO65798.1| monensin polyketide synthase modules 3 and 4; MonAII protmod 3357 ..........RLGTSGTATLENLSVIDAPEAAPLEPGQVRISVRAAGMN-----FRDVLIALGMYPDKGTFAGSEGAGHVTEVGPGVTHLSVGDRVMGLFGAFAPLAVADARMVVPIPEGWSFQEAA----AVPVVFLTAWYGLVDLGRLRAG--ESLLIHAGTGGVGMAATQIARHLGA-EVFATASPAKHGVLDGMGIDAAHRASSRDLDFEETLRAATGGGMDVVLNSLAGEFTDASLRLLAEGGRMVDMGKTDKRDPDRVAAEHAGAWYRAFDLVPHAGP---------DRIGEMLAELGELFASGALAPLPVQTWPLGRAREAFRFMSQAKHTGKLVLEIPP....3675
377  3.000e-41 84  Homo sapiens gi|34365444||emb|CAE46055.1| hypothetical protein [Homo sapiens] protmod 2 .IVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQLSQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQ.................................................................................................................................................................................. 173
378  3.000e-41 19  Ralstonia metallidurans CH34 gi|48769596||ref|ZP_00273941.1| COG0604: NADPH:quinone reductase and related Zn- protmod 12 ...................PDSLTLETLPDL-VPGDGEVVIDVKAAGVNFPDVLIIQNKYQAKPELPFSPGSEL--AGVVNAVGAGVTHVKPRDKVIAYNGAFASQAKAPAKAVVPMPPGIDFDVAAAFTLTYG----TSHHAVVDRGELKAG--ETMLVLGAAGGVGLAAIEIGKAIGA--RVIAAASTDEKLAVCKEHGADALINYSTEDLRERVKALTDGGPDVIYDPVGGVYAEPAFRSIAWRGRYLVVGFANGEIPKIPLNLALLKGASLVGVFW-----GEFARREPKANQANMAQMLGWMKEGKIRPHISARYPLEQAPQALKDMEARKVTGKIVIT....... 323
379  3.000e-41 20  Rhodopseudomonas palustris CGA009 gi|39935740||ref|NP_948016.1| quinone oxidoreductase [Rhodopseudomonas palustris protmod 4 ........AVRVHQVGGP--EVLVYEDVELPPP-GEGEVRIRQHAVGLNVYFRTGLYKAPSLPFVAGN------EGAGEVVSVGPHVTNFHPGDRVAANLGGYATERNIEAAKLVKLPDHITYEQGA----VLMLKGLTVWYLLHKTFKVEPGHRV--LIHAAAGGIGLLACQWARALGA-HVIGTVGSKAKA-DLALANGCDHVILYNEEDWVARVKQISRNELDVVYDGVGKATFPGSLKCIKPRGLFVSFGNASG-----PVPPFPLTELNNHGSLFATRPKLNDYIGTRKELIEGADTLFSAVIEGKLHVPINHAYALKDAAKAHIDLEGRVTTGASILK....... 323
380  3.000e-41 17  Legionella pneumophila subsp. pneumophila str. Philadelphia 1 gi|52841959||ref|YP_095758.1| quinone oxidoreductase [Legionella pneumophila sub protmod 24 ..........................ELTLVEGPNPGQILVRVKATALNRADLMQKYGKYPPPPGESDIPGLEVAGEVI--VTGSKVKQFKPGDKIYGLVGGYAEICPVDASLAHHIPSHWNYSLAA----ALPEALTTVYATLYDLGALSAG--QTLLIHGAGSGIASLAIQMAKLT--NTKVITTVGDSSKIEKALALGADQVIHYKEQDFELLIED---NSVDLIIDFVGGDYFNKHLHLLKPQGKLIQIACLKGSKVECSLALLMQKRLHIIGFVLR----SQSIKEKARLWKLAHDHWFNAFENDKIKPVIDSELDLNQIETALQRMQQGSHFGKIVIRVG..... 332
381  3.000e-41 16  Haloarcula marismortui ATCC 43049 gi|55379607||ref|YP_137457.1| quinone oxidoreductase [Haloarcula marismortui ATC protmod 15 ....................DVLEYGEFPDPEP-GRDEVVIDVKAAALNHLDIWTRRGLPGIDLEMPHIPGS--DAAGVVDEVGDGVSRFEPGDRVAVLAGVHSEYAAVPAENLTPVPEGVDWETAA----ASPLVFQTAWRMLRDRGDLKAG--ESVLVLGASGGVGHAAVQIADHAGA-EVFATASSQEKL-DYAKELGADHTINYEETDFASEIRDLTDGGVDMVVDHIGAQTWQDSLKSLVKGGRVVTCGATTGGNPETDINRIFWNQLQVIGSTM--------------ATPGQADEVLDLVWQGEMEPRVRETLPMSEIARAHEIIEDREGFGKVVVVPDSE... 347
382  3.000e-41 18  Exiguobacterium sp. 255-15 gi|53771726||ref|ZP_00184137.2| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................GSEQFKVGELD-RPIVGADDVLIAVHAASVNPVDWKLGYLKEMLSYDMPLVIGWDVS--GVIEEVGENVTDLKVGDEVFARQGTYAEYVAVDAHLVVKKPEALTFEEAA----SLPLVAHTAWQVMFEVMDAKAGDK--IFIGAGSGGVGTVAIQLAKAHGLH---VITSTSTKNVDWVKALGADEVIDYKQEDPADRVRDL-----DFVFDTMGGDGQAKLYQMLKPNGMLVSISTPPDEDQAKEAQARVAYVFMQPTGER-------------------LQHIAQAVERGELKPVVDRIFDLDQIKEAHDYGEEGHAKGKIVIKV...... 308
383  3.000e-41 22  Rubrobacter xylanophilus DSM 9941 gi|45545782||ref|ZP_00185906.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 ......MKAVRVHEPGGP--EALRYEEVPTPEP-GPGEVRVRLEACGVNFI------DVYHRKGLYPRQTPFVLGQEGAGRVVGEGVEEFSEGDYVAAPGGAYAEYAVVPADRLVPVNVTLVEARVA---AAAMLQGMTAHYLTHSTFPLEEG--HVALAHAAAGGVGLLLIQMAKMRGAT-IIGTAGTPEKARL-AREAGADEVILYTERDFVEETRRITGGGVHVVYDSVGRATFEGGLDVLRLRGYMVLFGQSSG-----PVPPVDLQILNQKGGLFVTRPSLAHYTATREELLWRAESVLSWIGNNTLKVRIGGTYPLAEAARAHADLEGRRTTGKLLL........ 322
384  3.000e-41 17  Brucella melitensis 16M gi|17989221||ref|NP_541854.1| QUINONE OXIDOREDUCTASE [Brucella melitensis 16M] g protmod 19 ......VIATRPG-----GPEVLELVPREL-PALKRGEMRVRIHAAGVNRPDAMQR----AGQYPPPPGVTDVLGLELSGVVIAEDVTRFGPGDRIMALVGAYSEEAIVQADVCIPVPAGLSMVEAAG----IPETYFTVWSNLFQRAGLQPG--ETVLLHGGTSGIGVTATLLAKAIGA--RMITTCGSDDKCRASEALGAIASINYRTTDFVEAGRALTEGGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEAQMDMGPLLFKRLTLTGSTLRAR----PLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAAHAHLEASAHTGKIILK....... 339
385  4.000e-41 20  Thermobifida fusca gi|48835656||ref|ZP_00292655.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 ......MKALRVHNLGEPK-DVLKLEEVPVPEP-APGQIVVRVLATAVNFPDALMCRGLYQEKPPLPFTPGVELCGEVVA--LGEGVTTVTEGDRVIGSYGSFAEYAPMDISRVFPAPPSLSDTEAA----ALFIGYQTGWFALHRRAGLQAG--ETVLVHAAAGGVGSAAVQLAKAAGA-RVIGVVGGAAKA-EYARKLGADIVVDRYVDDFVSVVKEATDGGADVIYDPVGGESYTRSTKCIAFEGRILIIGFASGTIPTPGLNHALVKNYSLLGLHWGLYNK-----RNPALVAHCHEELTALAERGAIKPAVSEVLSLEELPDGVQRLADGTTVGRLV......... 324
386  4.000e-41 17  Trichodesmium erythraeum IMS101 gi|48890758||ref|ZP_00324381.1| COG0604: NADPH:quinone reductase and related Zn- protmod 11 ..................IPDSLYITEIPL-PQPAAGEIRVQVHAVGLNPV-----DYKLAAGGFSTWSYPFILGLDVAGVVVGTDVTEWQVGEQVYYHPGAYAEYTNANALAVAPLPEGISFTKAA----AIPCAGFTAYHALHHRLHIQ--SKQTILIHGGAGGVGSFALQLASLAGLE---VITTCSQSNFDYVQKLGAKHLIDYKNQDVVIRVKEITNDGVDAILDTVGSETATTGLKMLAFNGGIACI-------AALPDFSNFKSFSLAASIHQIALGGAYLSGDKKADLGKMGREMGELVREKKVSPMLTEVISLEEIPKALNRLKGRHVRGKIVAEI...... 325
387  5.000e-41 16  Canis familiaris gi|57091463||ref|XP_548076.1| PREDICTED: similar to vesicle amine transport prot protmod 61 ..............TGFGGYDKVKLQSRGGPPAPGPGQLTLRVRACGLNFADLMARQGLYDR--LPPLPLTPGMEGAGVVIAVGEGVNDRKVGDRVMVLIGMWQEEVTVPSAQTFQMPEAMTFEEAA----ALLVNYITAYMVLFDFGNLRPG--HSVLVHMAAGGVGMAAVQLCRTVENVTVFGTA--SASKHEVLKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMALARTWWLQLLPANRAVCGFHLGYLEGEVEGVVARLLALYNQGHIKPHIDSVWPFEKVADAMRQMQEKKNVGKVLLVPGPE... 397
388  5.000e-41 17  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50122584||ref|YP_051751.1| quinone oxidoreductase [Erwinia carotovora subsp. protmod 2 ........AKRVQFRAYGGPEVLQYGDFTPAEP-AAGEVQVENHAIGINF---IDTYIRSGLYPVPDLPSGLGTEAAGVVTKVGAGVSVLKVGDRVVYALGAYSEVHNVVAEKVALLPDAISFEQAA----ASFLKGLTVYYLLRQTYEIKP--NQVFLFHAAAGGVGLIACQWAKALGA-KLIGTVGSDEKA-ERAKQAGAWATINYRTENIAQRVAELTDGKVEVVYDSVGKDTWEASLDSLRRRGLMVSFGNASGPVTGINLGILNQKGSLYVT-----RPSLFGYVTNRAELEQASNELFSLIASGAITVDVPQKFALADAQAAHRALESRSTQGSCLL........ 325
389  5.000e-41 20  Debaryomyces hansenii CBS767 gi|49657056||emb|CAG89794.1| unnamed protein product [Debaryomyces hansenii CBS7 protmod 10 ...QKVVL----FEENSDSVDVIKYTDFDTPKIAAPNEIIIKNKFAGVNFI------DSYFRKGIYPSQKPHIFGREAVGVVVGDKVTKFSVGDKVAYLSGTFAQYTKLTDSYVLKLDPSTSDESLKFYAAAL-LQGLTALTFIHEAYAVKKGDYV--LVWAAAGGVGKILTQLISQQGA-HVIAIA-STEEKLALAKKYGAEYGVNHLTDDIVEKVKEITDGGVNASFDSVGKDSAEISLTSLARKGTFVSYGNSSGVVPPLSINRLSPKNLTV------LRPQLLGYLTTSEEWEHYVRLLFKLIDSGDLKIDILKTYPLSEYKQATSDLEGRKTTGKLVLEV...... 336
390  6.000e-41 21  Ralstonia metallidurans CH34 gi|48770077||ref|ZP_00274421.1| COG0604: NADPH:quinone reductase and related Zn- protmod 4 ........VVRIYETGGP--DVLRFENATVGEP-GPGEVRVRHVAVGLNFADTYFRSGL----YKVPLPSSIGNEAAGVIEAVGSGVTHLAVGDRVTYTLGAYSTDRLISADPLIKLPEAISCEVAA----AMTMRGLSAAYLMRRIYPFKAGD--TILLHAAAGGAGLIISQWAKLLGLT--VIGTVSTDAKAEVARAHGCDHTINYSHEDVAKRVRELTDGGVSVVFDSVGKDTFMSSLDSLKRRGLLVCVGFASGA------VPAFDPAILARKGSAYLTRPGLADYADPAEKAELVDELFGHVAAGRIRIDINRRYALEDAVQAHRDLEARKIVGSSIFAI...... 326
391  6.000e-41 22  Ralstonia metallidurans CH34 gi|48770407||ref|ZP_00274750.1| COG0604: NADPH:quinone reductase and related Zn- protmod 5 ......VRAVRLHEFGLPQ--VMRLESVELPPP-AAGEARVRHTAIGIDVYQRRG-------TYPLPVGTGLGHEAAGVVEAIGDGVTDVAVGDRVAYMNGAYAEGRNIPVDKLVKLPDAISDEQAA----AVIFKGMTAQYLVRHTYAVKPGD--TVLVHAAAGGVGQILSGWAKALGA-RVIGTAGSAA-KCEIARAVGCDVAIDYSHGDWVKQVRDATDGGVNVVYDAVGKDTFLGSLDCAQTFGMVVLYGGASG-----PAPAIEPELLNKKGCLYLTRPSVFPHNADATRFRANAKDLFDAIAAGHVKVQIGARFPLADVARAHEAAEGRATTGAILL........ 325
392  6.000e-41 16  Aspergillus nidulans FGSC A4 gi|40742256||gb|EAA61446.1| hypothetical protein AN7194.2 [Aspergillus nidulans protmod 8 ...............GGKGPADALYIDNIPVPEYGPSQALVKVKAFGLNRMDLLQREGQYPVPPQAPATLGVEFSG-TIAELGDGATEDFKVGDEVFGLGGAYAEYIAVATGMLIHKPKELSWEEAAG----IPETWITATQALHLVGAFKPGNSV--LWHAGASSVSIAGIQLAKAAGASAIYVTAGSDEKISFCVNQLGATAGFNYRTQNWAEELSKATNGGVDVIVDYIGAGYFQDNLKSAALDGRIVNLAFLGGIKVE--------NVDISYFLRKRIRYEGSTLRSRDEEYQRKLRNMLEKLRNKEFKVFVEKVFKFDDVVEAHKLMESNQTKGKIICTI...... 330
393  6.000e-41 19  Pseudomonas syringae pv. syringae B728a gi|23469374||ref|ZP_00124708.1| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ........AKRIQFNTVGGPEVLEYVDFE-PQAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPSLPS---GLGAEGAGVVEAVGAEVTRFKVGDRVAGPLGAYSEVHVLPEANLVKLADSISFEQAA----ALMLKGLTVQYLLRQTYQVKPG--EIILFHAAAGGVGSLACQWVKALG-GKLIGTVSSPEKA-AHAKALGAWETIDYSHEDVASRVLELTDGKCPVVYDGVGQDTWLTSLDCVAPRGLVVSFGNASG-----PVSGVNLGILAQKGSVYVTRPTLGSYANTAQNLQAMADELFDMLASGKLKVDGIQQYALKDAARAQTELSARRTTGSTIL........ 323
394  6.000e-41 17  Synechococcus elongatus PCC 7942 gi|45512120||ref|ZP_00163687.1| COG0604: NADPH:quinone reductase and related Zn- protmod 16 ..................GPEQLQLQSLPWPAIAHPSEVLVQLQAAGLNPIDTKLRQRGSFDPDRRPAILGCDGAGWVAA--VGSAVDRFAVGDAVYFCHGGYADYAVVDQAWLAPKPERLSFVEAAGVPLAL----ITAWEALYDRGRLQA--AQTVLIHAGAGGVGHLAIQLAKLRGA--RVATTVSTPEKAAIAEHYGADFVIPYRDRDWVAAVLDWTDGGVDLAFDTVGGAVLEQTFPAVRLYGDLVTILAPDAATNWKVARDRNLR----ISLELMLTPQLQRVTEARQHQTQILTTASRWFDQEQLHIHIGQVLPISEISQAHQFLERQQGAGKIVIDL...... 336
395  8.000e-41 18  Mycobacterium avium subsp. paratuberculosis str. k10 gi|41407278||ref|NP_960114.1| Qor [Mycobacterium avium subsp. paratuberculosis s protmod 10 ........AIEVSETGGP--EVLRYVETPT-PTAGPGQVLIKAEAIGVNYI------DTYFRSGQYPRELPFIIGQELCGTVAGDGVDGFNVGDRVVAATGGYAEYATAPASLTAHVPDGVAADVAASAL----LKGLTAHYLLKSVYPVQAGD--TVLVHAGAGGVGLILTQWAHLLGA--RVITTVSTPEKARRSAQAGADEVLSYPDDEFGSRIRALTDGGVAAVYDGVGASTFDASLASLAVRGTLALFGAASG-----PVPPFDPQRLNAAGSVFLTRPSLAHFIRTGQEFSWRAEELFAAIAAGDITVEVGGRYPLADAARAHRDLQGRKTTGSIVL........ 329
396  8.000e-41 15  synthetic construct gi|30585179||gb|AAP36862.1| Homo sapiens vesicle amine transport protein 1 homol protmod 54 ..............TGFGGYDKVKLQSRAAPPAPGPGQLTLRLRACGLNFADLMARQGLY--DRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNGMWQEEVTVPSVQTFLIPEAMTFEEAA----ALLVNYITAYMVLFDFGNLQPG--HSVLVHMAAGGVGMAAVQLCRTVENVTVFGTA--SASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMALARTWWLQLLQANRAVCGFHLGGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPE... 390
397  8.000e-41 19  Polaromonas sp. JS666 gi|54029846||ref|ZP_00361986.1| COG0604: NADPH:quinone reductase and related Zn- protmod 13 ....................DALTWKELPT-PQPKEGEVLIEIKAASLNFPDLLIVQNKYQIKPPLPFVPGS--EYAGVVQAVGEGVKHLQVGQNVACLTGGFGTHTIAPAALCMPLPAGFSHVDAAAFIMI----YATSWHALMDRAQLKAG--ETVLVLGAAGGVGTAAIQIAK--AAGARVIAAASTDEKCAFCSALGADATINYTSKNLRDEIKTLTGGGPDVIYDPVGGDFAEPAFRSIAWRGRYLVVGFASGPIPSLPLNLALLKGASIVGVFW-----GDFARREPKANAAMMAELARWYTEGKIKPAIDRTMPMAELKAAYAYMGSRGVKGKLV......... 321
398  8.000e-41 22  Rubrivivax gelatinosus gi|11250326||pir||T50915 hypothetical protein ORF326 [imported] - Rubrivivax gel protmod 21 .............................PTPEPAPGEVRVAIRAASLNFPDLLIVEGKYQARPPLPFVPGAEF--AGVVEALGEGVTTLAVGQAVIGTHGGFATHACVDAGRAIALPPGFALEDAAAFAFTYG----TSQHALLDRGALRPG--ETVLVLGAAGGVGTAALQIAKAVGA--HVIAAASGAEKCALCRELGADAVIDYSVENLRDALKALTGGGPDLVYDPVGGELAEPALRSIAWRGRYLVVGFASGAIPALPWNLALLKGASIVGVFW-----GEFVRREPQASAAAIGQLARWYAEGRIKPVVGARFALEDLPQAYERMASRRALGKLIV........ 322
399  9.000e-41 18  Magnaporthe grisea 70-15 gi|38101688||gb|EAA48612.1| hypothetical protein MG00270.4 [Magnaporthe grisea 7 protmod 19 ....................DDLKLETSAPVPKPGENEVLVKLHGASLNY----RDLIIPRGQYPFPLDLPVVAGSDGAGEVVGSKVKEFKVGDRVVTLFGTLRQYGVFAETGLVRAPENLDFVEAASLTCA----GLTSWNALYGCKPVKPGD---VVLVQGTGGVSLFALQFAKAVGCT--VIATSSSQDKLDMLKKLGADHVINYEDKNWGETARKLTKGGVDNIIEVGGLGTFEQSLKAIKYEGIISVIGFLGGAAGE--------KMPSVISSLSSITIRGTYVGP-----RSMMEDMVRAIEVNNIHPVMDKTFSLDQIKEAYEYMWNKKHIGKMTIKID..... 348
400  9.000e-41 15  Homo sapiens gi|30583577||gb|AAP36033.1| vesicle amine transport protein 1 homolog (T califor protmod 54 ..............TGFGGYDKVKLQSRAAPPAPGPGQLTLRLRACGLNFADLMARQGLY--DRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNGMWQEEVTVPSVQTFLIPEAMTFEEAA----ALLVNYITAYMVLFDFGNLQPG--HSVLVHMAAGGVGMAAVQLCRTVENVTVFGTA--SASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMALARTWWLQLLQANRAVCGFHLGGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPE... 390
401  1.000e-40 17  Brucella suis 1330 gi|23463741||gb|AAN33589.1| alcohol dehydrogenase, zinc-containing [Brucella sui protmod 8 ......VIATRPG-----GPEVLELVPREL-PALKRGEMRVRVHAAGVNRPDAMQR----AGQYPPPPGVTDVLGLELSGVVIAEDVTRFGPGDRIMALVGAYSEEAIVQADVCIPVPAGLSMVEAAG----IPETYFTVWSNLFQHAGLQPG--ETVLLHGGTSGIGVTATLLAKAIGA--RMITTCGSDDKCRASEALGAIASINYRTTDFVEAGRALTEGGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEAQMDMGPLLFKRLTLTGSTLRAR----PLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAAHAHLEASAHTGKIILK....... 328
402  1.000e-40 19  Methylococcus capsulatus str. Bath gi|53756816||gb|AAU91107.1| alcohol dehydrogenase, zinc-containing [Methylococcu protmod 2 ....KAIVMTRPGE----AAEVLELRDLPEPALTAPTQIKVRLRAAGVNPIDTKVRRRGLFYDDALP----AVLGCDGAGEVVEAGVDRFRIGDRVWFCNGGYAEYTVLDQRWAAPMPASSAFASAAAGPLVL----ITAWGALYDRGRLQPG--QTVLVHAAAGGVGHVAVQLAKLRGA-RVIATVGS-EDKAALARGWGADETIDYRTQDFVAEVNALTGGGADLVLDTVGPEVFRRSVECTAHFGDLVTL-----LDTGATSLAEARMRNLRIGFELMLVPMLRKLDAARDHHVEILRACGEWIDDGKLELYVSGVHPLEEAARVHDIIEAGHTTGKRVLCID..... 332
403  1.000e-40 21  Sinorhizobium meliloti 1021 gi|15965424||ref|NP_385777.1| PROBABLE QUINONE OXIDOREDUCTASE PROTEIN [Sinorhizo protmod 1 .MAQAIVVRE------LGGPEVLKMEGVTLA-APGPGEVQIRQVAIGLNFIDVYFRTGLYKSATGLPFIPGK--EGAGVVTAVGDGVSMFSVGDRVASADGAYASERNVDASQLLKVPEGISLETAA----AMMLKGMTAQYLLNQTFKV--GPETTLLFHAAAGGVGFIAGQWAKALGAT-VIGTAGSQE-KIDLALAHGYDHVINYRTDNFVERVKDLTGGGVDVVYDSVGRDTYPASLDCLKPRGLWASFGNSSG-----PVDAFNIGILAQKGALYATRPTLFTYVATRPALEACANSLFDVVQSNKVRININQTYPLAEAGRAHTDLETRKTSGTTLL........ 323
404  1.000e-40 15  Homo sapiens gi|32425722||gb|AAH01913.2| VAT1 protein [Homo sapiens] protmod 50 ..............TGFGGYDKVKLQSRAAPPAPGPGQLTLRLRACGLNFADLMARQGLYDR--LPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNGMWQEEVTVPSVQTFLIPEAMTFEEAA----ALLVNYITAYMVLFDFGNLQPG--HSVLVHMAAGGVGMAAVQLCRTVENVTVFGTA--SASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMALARTWWLQLLQANRAVCGFHLGGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPE... 386
405  1.000e-40 18  Streptomyces nanchangensis gi|31044147||gb|AAP42859.1| NanA5 [Streptomyces nanchangensis] protmod 3225 ................AGTVDGLAPEECPEVEPLAPGQVRIAVRAAGVN--------FRDVMVTLGVVPDRRGLGGEGAGMVVAPDVTSVAVGDRVMGLFGSFGPIAVADARALVPVPPGWTDRQAA----AVPIAFLTAWYGLIDLAGLKAG--ESVLIHAATGGVGTAAVQIARHLGA-VIYATASPGKHPMLEAMGVDETHRASSRDLDFEHIFRAATGEGMDVVLDCLAGEFVDASLRLLGQGGRFIEMG-----KTDIRDPEQIADTHPGVHY----RSYDLVSDAGLDRLSEMLGTLADLFAQGVLTPPPVQAWPLARARQALRHMSQAKHTGKLVLDIPP....3536
406  1.000e-40 17  Nostoc sp. PCC 7120 gi|17129757||dbj|BAB72370.1| all0412 [Nostoc sp. PCC 7120] gi|17227908|ref|NP_48 protmod 9 ................FGSPEVFTEVEVN-KPTPANNEVLVKVYATSVNPADCGMRRGFFGPRVQLPAILGFDVS--GVVEAVGENVRDFQVGDEVYYAIGANAEYHAFPSSMIAKKPNNISHLEAATVPVAGG----TAWAALITRANLQVG--ETVLIHGGAGGVGTFAIQIAKAAGAY---VYTTCGGYDIDFVKSIGADRAIDYRNEDFTNIIMQETGGGVDITFTTVAGETLAKSLLVTKENGRAVTITGVTGD--------------LNTAIFKNIT----IHFVHLDDTHSKLNALRSLIERRQIKPIFGITYPLNQLAAAHKKLEEGGIRGKIAIEVN..... 317
407  1.000e-40 19  Bacillus cereus ATCC 10987 gi|42782547||ref|NP_979794.1| quinone oxidoreductase [Bacillus cereus ATCC 10987 protmod 7 ............EQFGNP--DVLQYKELND-PIINPNEILVRTKAIGLNFADIYRRRGDYHLAGNPPYILGY--EGAGIVEKVGADVTNIKPGDRIAFADVPFAELVAVPSKKAIPLPDSISFETAASVL----LQGLTAHYLTKDSYEIKQGDIA--LVHAAAGGVGQLLIQIIKLLGGKVIGLTSAKEKAQIATLS--GADHVFLYTEAWPAKVLEITNGTGVNVVYESVGS-TLEESFSATKTGGTVVFYGMAGG--NPAPVDPRMLMDTSKTLTGGDL----WNVLTTFEERKKRSTQLFDWIASGKLNIASPTTFSLQDGARAHELLESRKSTGKILL........ 319
408  1.000e-40 19  Gallus gallus gi|50745109||ref|XP_419987.1| PREDICTED: similar to tumor protein p53 inducible protmod 156 ...............................PLPGEGEVLVKVSASALNRADLLQRRGK----YPPPKGSSDILGLEAAGSVLGPGCTGWKIGDAVMALLGGQAEYVTVPEGHLMPVPKDMTFIQAA----AIPEAWLTAFQLLHFVGKIQKG--ETVLIHAGASGVGMAAIQLVRLANAI-PIVTAGTQEKLQ-ATTNAGAAAGFNYKNEDFSEKVLAFTQGGVDIILDCVGGSYWEKNLSCLRTDGRWVIYGLLSGGEV---HGDLLARLLSKRGSIHTSLLRSRDKEYKEQLVKAFIENVLPYFSGGHLQPFVDSVYPLHEIVEAHRKMEESKNIGKIVIEM...... 463
409  2.000e-40 19  Canis familiaris gi|57100579||ref|XP_533315.1| PREDICTED: similar to crystallin, zeta [Canis fami protmod 181 ....................EVLKLRSDVAVPIPKDHQVLIKVHACGVNPVETYIRSGTYRRKPLLPYTPGSDV--AGIIEAIGENVSTFKKGDRVFTISGGYAEYALASDHTVYILPEKLDLKQGA----AIGIPYFTAYRALLHSARAKAG--ESVLVHGASGGVGIAACQIARAYGL-KVLGTAGTEEGQN-IVLQNGAHEVFNHRELNYIDKIKKSVGEGIDVIIEMLANVNLSNDLDLLSYGGRVIVVG--SRGPIEINPRDTIPKETSIIGTA--------LYSSTKEEFRKFAMALQAGMEIGWLKPVIGPQYSLEKVVQAHENIHSSGAIGKMIL........ 488
410  2.000e-40 22  Burkholderia fungorum LB400 gi|48783834||ref|ZP_00280215.1| COG0604: NADPH:quinone reductase and related Zn- protmod 12 ...................PESLVVENLPDLVAP-PGHVVIDVKAAAVNFPDVLIIENKYQFKPPLPFTPGSEL--AGVVRAVGADVTQFKPGSRVVAFQGGFAEQALAPASACVPLADGVEFELAAAFTLAYG----TSHHAVVDRGALQAG--ETMLVLGAAGGVGLAAVEIGKALGA-RVIAAASNDEKLAICVKH-GADATINYSTEDLRERIKALTDGGPDVIYDPVGGVYAEPAFRSIGWRGRYLVVGFANGEIPKLPLNLTLLKGASLVGVFW-----GDFARREPQHNHAAFGQMTRWIAEGKLKPYVSARYSLEDTGRALRDMAERRVIGKVVVT....... 323
411  2.000e-40 17  Ralstonia eutropha JMP134 gi|53761049||ref|ZP_00166341.2| COG0604: NADPH:quinone reductase and related Zn- protmod 4 ................GPEGGKVEVQDIPV-PVAGPGQVLVRVRASGLN---RGEINQAKELRTGNTITTGVEFAGEVA--EVGEGVHGWRKGDRVMGHGKGCAEYVVSDPMALIAVPDGMSWIDAAAF----PNVFITAHDALVVNGQLKQG--ESVLVNGASGGVAMAAIQIASLMGAKPVIAQSRSAAKL-DKLSQYGVDVCIDSSKDDQVEKVMEATGNGVDVIIDTVGGPVFEANMKSLAVQGRLVNIARLGSATAQIDLAQLWLKRLHLI----GVTFRTRTEQERLECIQACARDMLPFLRAGRVRLPIDRTFAMTDIHAAHAYMKQDQHVGKIVLLVD..... 318
412  2.000e-40 16  Corynebacterium efficiens YS-314 gi|23492015||dbj|BAC16990.1| putative quinone oxidoreductase [Corynebacterium ef protmod 15 ......................LELQDVPV-PTLKPGEVLVEVKAAGVNRADLLQTQG----NYPVPPGASEILGLECAGIIADPGDTGRSKGEEVACLLGGYAEFVAVPEGQLMPIPEGFSFVEAASIVEVA----CTVWSNIGMLAGLKEG--QTFLVHGGAGGIGTFAVQMGKAMGAT--VAVTTGSPEKLQTCQQLGADILINYREEDFAEVLK----NRADVILDIIGAKYLGQNVKALAKDGHMVTIGLQGGVKGELNLGLLLAKRGTISATALR----GRDDADKARIVAATVEAIWPMLADGRITPHIDHTLPLADAAKALKALEDGTVTGKLVLEV...... 318
413  2.000e-40 18  Silicibacter sp. TM1040 gi|52009435||ref|ZP_00336798.1| COG0604: NADPH:quinone reductase and related Zn- protmod 1 ......MRAIEISEFGAP--NVLKLVERPV-PSAGYGQVVIRVAYAGVNRPDALQRAGAYAPPKGASDLPG--LEASGEIVALGEGVTGWNLGDRVCALLGGYADYVATPAAHCLPVPKGLSLKEAA----CLPETCFTVWSNVVTRGGLRAG--ERFLVHGGSSGIGTTAIQLASALGA-RVYATAGSDDKCAACV-GLGADVAINYRDEDFVEILRA--DGGAHLILDMVGGDYIPRNIKALADDGRLVHIAFLQGPKAELNFAQIMARRLTVT----GSTLRPQSDLAKARIARDLLEAVWPLIEAGKLRPVMDSTFALAEAAIAHARMEGSTHIGKIVLEVA..... 323
414  2.000e-40 21  Pan troglodytes gi|55647581||ref|XP_512178.1| PREDICTED: similar to zinc binding alcohol dehydro protmod 418 ...........................................RFVGVNASDINYSAGRYDPSVKPPFDIGF----EGIGEVVASASARYTVGQAVAYMPGSFAEYTVVPASIATPVP-SVKPEYLTLLVS-----GTTAYISLKELGGLSEGKKV--LVTAAAGGTGQFAVQLSKKAKC--HVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMGHLLEMCVSGDLVCEVDRFTGLESIFRAVNYMYMGKNTGKIVVELPHS... 720
415  2.000e-40 18  Rhodopseudomonas palustris CGA009 gi|39933477||ref|NP_945753.1| possible alcohol dehydrogenases and quinone oxidor protmod 11 ..................GPDDLVYADVPD-PVAGPGEAVIAVKAAALNFFDILMIQGKYQIKPPFPFSPGAEV--AGVIESVGEGVTDLKVGDRVVASCGGAREKIALPAQMIVKIPDNLDFDRAAGIIIIYG----TALHALEDRASPKPG--ETLAVLGAAGGTGLAACELGKLMGLK--VIACASSEEKLAFAKQHGAELTLNYATEDLKEGLKKLTGGGVDIIFDPVGGTYAEAALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGA-----WTRLNPEKNRANLEKLVKWAAEGKISSHVDRTFPLAQTADALKVLAGRQAMGKVILH....... 323
416  2.000e-40 18  Gibberella zeae PH-1 gi|42552922||gb|EAA75765.1| hypothetical protein FG05690.1 [Gibberella zeae PH-1 protmod 16 ................NGGVEVLEHNDVPV-PKVGEGQILVRNQIAGLNF---IDTYFRSGLYKAPQFPLTLGREAAGTIVDIHSSVKGFENGSRVMGTVGAYAQYSVVNASDAVKIPDDVPTEQAV----AAYLQGLTAWTFIREAGQVKEG--QWVLVHAASGGVGTLLVQLLRTVGAK--IIGTASTDEKLELAKKNGAEWVISSHDDVVAKVKEITGGHGADVIFDGVGKVTFDADLELIAPKGTLISFGNASGAVDPVSLFRLTP---------KNVRLMRPVVNGYRADLEKYTSELFDLIKSKKLELTIHKVYPLADVAKAHEDIESRKTIGKLLIKVD..... 329
417  2.000e-40 14  Pseudomonas fluorescens PfO-1 gi|48729429||ref|ZP_00263180.1| COG0604: NADPH:quinone reductase and related Zn- protmod 44 ............................APAPAVGAHDVLIEVHASSVNVLDSKISKGEFKL--ILPYAFPLILGNDLAGVVVEVGVTRFKPGDEVYARPGTFAQLIAVNENAVALKPANTDMAQAA----SLPLVALTAWQVLVETARLQKGQKV--LIHAGSGGVGTVAIQLAKHLGA--FVATTTSTANV-EWVKALGADLVIDYTQQDFASVLHD-----YDVVLNSLGADVLEKSLKVLKPGGQLISISGPPTVQFAREHGLSWPLQQVMRLLSLGIRRKASYAFVFMRANGAQLQHITALVEDGIIKPVVDRSFLFESTAEALKYVERGRAKGKVVVAL...... 356
418  2.000e-40 14  Nocardia farcinica IFM 10152 gi|54022186||ref|YP_116428.1| putative quinone oxidoreductase [Nocardia farcinic protmod 7 ..............NGFGGPEVLVWGKAAD-PVPGHGEVLIDVVAAGVNRADLLQRQG----NYPPPAGASDILGLECSGVVVGEGVREWQVGDRVCALLGGYAERVVVPATQVLPVPEGMDLAAAAG----LPEVAATVWSNLVMTAGLHAG--QLVLIHGGGSGIGTHAIQVARQRGA--RVAVTAGSAEKLERCRELGADVLINYREQDFVEVVRAQESGGADIILDNMGAAYLGRNVAALAPHGHLVIIGMQGGVTGELNVGALLGKWGSVHATNVR-NRPATGTGSKAEIIAEVRRHLWPLVADGAVVPVIHAEFDIADAAQAHRVLDSSRAFGKVVLRVREE... 334
419  3.000e-40 15  Corynebacterium glutamicum ATCC 13032 gi|19551454||ref|NP_599456.1| NADPH:quinone reductase or related Zn-dependent ox protmod 23 ......................LELQEVPV-PTLKPGEVLVEVKAAGVNRADLLQTQG----NYPVPAGASEILGLECAGVIVDAGDTGQTVGQEVACLLGGYAQYVAVPEGQLMPIPEGYSFVEAASIVEVA----CTVWSNIGMLAGLQKED--TFLIHGGAGGIGTFAIQMGKALGVT--VAVTAGSTEKLKTCKNLGADILINYKEEDFAEVLK----NKADVILDIIGAKYLSQNVKAMAKDAHMVVIGMQGGVKGELNLGHLLAKRGTISATALRGRDE----ADKARIVSSTVENIWPLLQSKEITPHIDHTLPLAEAAAALQKIQDGTITGKLVLAV...... 326
420  3.000e-40 19  Rubrobacter xylanophilus DSM 9941 gi|46106600||ref|ZP_00187524.2| COG0604: NADPH:quinone reductase and related Zn- protmod 2 ........................LEEREVRPQPGPGELLVRVVAASANPADAKLRANGQSMGLKAPVILGADVS--GVVEEVGPGVEEFSPGDEVYYANGAYAEYHVVEAGIVAPKPPSLSHEEAA----AVPLAGGTAYEAIVRRLAV--GVGETVLIHGGAGGVGSFAVQIARAAGA-RVIATAGPDNQKTL--EELGADVALDYTRDDITEAALEDTGGGVDAVFDTVGGETVARSVEATAPFGRMATI---LGARGDLTNMYPKNQALYGVLLTRE---------------RERLEEMAVLLERGQMRPLIDRVLDLGETARAHERLDSGHGRGKIVLRVAR.... 305
421  3.000e-40 14  Mycobacterium leprae TN gi|15826951||ref|NP_301214.1| putative oxidireductase [Mycobacterium leprae TN]