Homologs of:

1vkb_A mol:protein length:161 Hypothetical Protein
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# E-value %id Organism Protein Model Start MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFEDCPSMYQRTALQVQVLEWEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENREnd
3.000e-58 92  Rattus norvegicus gi|34876150||ref|XP_214256.2| similar to cDNA sequence BC006662 [Rattus norvegic protmod 1 MAHIFVYGTLKRGQPNHKVMLDQSHGLATFRGRGCTVESFPLVIAGEHNIPWLLHLPGKGHCVAGEIYEVDEQMLRFLDDFEGCPSMYQRTALQVRVLEWEGAGGPGDSVQCFVYSTATYAPEWLFLPYHKNYDSEGPHGLRYNPRENR 149
9.000e-57 70  Pan troglodytes gi|55640051||ref|XP_522710.1| PREDICTED: hypothetical protein XP_522710 [Pan tro protmod 230 MALVFVYGTLKRGQPNHRVLRDCAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRRVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEETAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR 382
3.000e-56 70  Homo sapiens gi|51471375||ref|XP_373431.3| PREDICTED: hypothetical protein BC004360 [Homo sap protmod 210 MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEETAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR 362
1.000e-55 69  Canis familiaris gi|57103392||ref|XP_542653.1| PREDICTED: similar to CDNA sequence BC006662 [Cani protmod 212 MAPVFVYGTLKRGQPNHKVLLDGTNGCAAFQGRGRTVEPYPLVIAGEHNIPRLLNLPGQGQCVVGEIYAVDEQMLRFLDEFEGCPDMYQRMLVRIAVLEWEETLASDGTLQCFVYSTGTYSPEWVHLPSHDNYDSHGKHGLRYNPRENR 367
5.000e-53 70  Homo sapiens gi|13279332||gb|AAH04360.1| LOC87769 protein [Homo sapiens] protmod 64 MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEETAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR 216
5.000e-52 60  Gallus gallus gi|50730609||ref|XP_416969.1| PREDICTED: similar to cDNA sequence BC006662 [Gall protmod 10 MARVFVYGTLKKGQPNYKHMINTAKGIAKYQGRGRTVEKYPLVIAGKYNIPYMLNIPGTGHHIAGEIYTVDDQMLRFLDEFEGCPDMYQRTTMRIEVVEWEGKSGTAEVMECFVYNTSTYQPEWVQLPYHDNYDSSGTHGLSYVLRENR 165
2.000e-51 70  Homo sapiens gi|33875960||gb|AAH01077.2| LOC87769 protein [Homo sapiens] gi|57160723|emb|CAI3 protmod 1 MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEETAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR 153
3.000e-48 52  Danio rerio gi|52218940||ref|NP_001004544.1| zgc:92115 [Danio rerio] gi|51858490|gb|AAH81599 protmod 1 MPLVFVYGTLKKGQPNYFRLIDSSNGQAEFITCARTVEPYPLVITGECNIPFLLNVPGSGQRVYGEIYSVDQKMLEFLDWFEECPDWYQRTLIQLEILKGNGETEVEE---AFVYTKTKYEPDWLNKPTYDSYDSNGDHGLKYAYEED. 145
2.000e-45 43  Drosophila pseudoobscura gi|54635435||gb|EAL24838.1| GA15466-PA [Drosophila pseudoobscura] protmod 7 LSKLFVYGALKYGQPSNSILASSSNGFAKFWCKATTTEKLPLVIATRYNIPFLLNKPGIGYYVTGEIYEVDDRMLNSLDNLEDCEDIYTREKQDMNIGVGEG------TIPCWVYLLQKYPEKLLSLQYLSSYENSSTH--PYIMRHRR 147
10  5.000e-45 40  Drosophila pseudoobscura gi|54635434||gb|EAL24837.1| GA15469-PA [Drosophila pseudoobscura] protmod 5 .ARVFVYGTLKSGEPNHQWLTKKENGQAQFLGRGTTAVKFPLVVGTRYNIPFLLDRPGDGHNIHGEIYEVDEAMFSKLDQLEDYPNYYDREEQTIR-------TETEGNLQCWLYLIRKFPVKMLAKPQLSAYHN--TPEQPYSEKSVR 143
11  4.000e-44 41  Drosophila melanogaster gi|28573638||ref|NP_611982.2| CG2811-PA [Drosophila melanogaster] gi|28380685|gb protmod 9 .ARVFVYGTLKRGEPNHHWLTKKENGQARFLGRGKTETKFPLVVGTRYNIPFLLARPGEGNHIEGEVYEVDETMLSKLDILEDYPDYYDREQQTIL-------MEQNETIQCWLYLIRNFPDKMLAKELLISYHN--TPERPYNEKSVR 147
12  1.000e-43 42  Drosophila melanogaster gi|24762794||ref|NP_611983.2| CG2803-PA [Drosophila melanogaster] gi|7291879|gb| protmod 11 LSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGYYVTGEIYEVDDRMLNSLDNLEDCEEIYTREMHDMNIGVGEG------TVPCWVYLLQKYPENLLSLRYLSSYENSTTH--PYIMRHRR 151
13  2.000e-42 39  Anopheles gambiae str. PEST gi|55242888||gb|EAA07026.2| ENSANGP00000016842 [Anopheles gambiae str. PEST] gi| protmod 6 LRRVFVYGTLKRGEPNHHLLANADNGYAKFICKGSTNRRFPLIVATRYNIPFLLDKPGTGSYVTGEIYEVDDPLFEQLDVLEDYRKLYDRQVEDINVGIE------GGNLPCWLYLLRNCPDRLLKLPMLTEYRNEQPYSRR....... 143
14  3.000e-39 39  Caenorhabditis elegans gi|51536882||gb|AAU05572.1| Hypothetical protein F42A10.9 [Caenorhabditis elegan protmod 6 ..KVFVYGTLKTGEPNYKVLSE-TDGEYRFISSGTTVEKFPLVVGTKYNIPFLLDDAGNGNNIEGEMYEVCEKKLKVLDELEAYPTLYDRKKVEIKL-------PSGTTETAFIYLLKSWRPDLLSTSMMTNYSSLGAHGRPYVDSEN. 145
15  6.000e-38 58  Xenopus laevis gi|51593180||gb|AAH78529.1| MGC85358 protein [Xenopus laevis] protmod 1 ...................MTCYKHGKAVFKGMGKTVEKYPLVIAEEANIPFLLNIPGTGRRIIGEIYSVDEQLLHFLDDFEGCPNWYQRTPQEIEILEWEGTDDSPDEITCFVYSTTCYQPEWLQLPYHKCYDAFGNHGLRYI-RHR. 135
16  4.000e-35 41  Anopheles gambiae str. PEST gi|55242887||gb|EAA07053.2| ENSANGP00000017416 [Anopheles gambiae str. PEST] gi| protmod 5 LRRVFVYGTLKRGEPNHHWLTDAANGQARFIAKGRTVGRYPLVVATRHNVPFLLDVRGTGHSVVGEIYEIDDRMLGRLDVLEDYPQLYDRRPEEIRNETSSAVEC------CWVYLIRSFPKRLLELPLLEEYRD--TPEKRYAE.... 141
17  4.000e-31 34  Oryza sativa (japonica cultivar-group) gi|29126342||gb|AAO66534.1| expressed protein [Oryza sativa (japonica cultivar-g protmod 28 ...VFTYGTLKRGFSNHGLLQDARDGDASFVGAATTAPRLPLV-CGPYRVPFLLNLPGAGHRVSGELYAVTPRGLDRLDELEGVRAHYERLPISVLLAEGAQVDAVA------YYAHRGYADDLWARSGKKGYPEYSPAADGYIRRKDR 169
18  2.000e-30 36  Arabidopsis thaliana gi|21555032||gb|AAM63759.1| unknown [Arabidopsis thaliana] protmod 14 ...VFTYGTLKRGFSNHVLMQDLRSGDASFKGVYQTLDKYPLV-CGPYRVPFLLNKPGSGYHVTGELYAVSPRGLSRLDELEGIRGHYIRQPIRLEEEEEEGDLETEAPSSCVVYAHKSYEEELWKR---NRGRSFGAYARGYVKRNDR 168
19  1.000e-29 35  Arabidopsis thaliana gi|21464585||gb|AAM52247.1| AT3g02910/F13E7_14 [Arabidopsis thaliana] gi|1738123 protmod 14 ...VFTYGTLKRGFSNHVLMQDLRSGDASFKGVYQTLDKYPLV-CGPYRVPFLLNKPGSGYHVNGELYAVSPRGLSRLDELEGIRGHYIRQPIRLEEEEEEGDLETEAPSSCVVYAHKSYEEELWRR---NRGRSFGAYARGYVKRNDR 168
20  1.000e-29 35  Arabidopsis thaliana gi|6728970||gb|AAF26968.1| unknown protein [Arabidopsis thaliana] gi|11387354|sp protmod 9 ...VFTYGTLKRGFSNHVLMQDLRSGDASFKGVYQTLDKYPLV-CGPYRVPFLLNKPGSGYHVNGELYAVSPRGLSRLDELEGIRGHYIRQPIRLEEEEEEGDLETEAPSSCVVYAHKSYEEELWRR---NRGRSFGAYARGYVKRNDR 163
21  9.000e-27 34  Ralstonia eutropha JMP134 gi|45515364||ref|ZP_00166919.1| COG2105: Uncharacterized conserved protein [Rals protmod 1 MPKVFVYGTLRAGEVNDLNTAAHRHGIAAPTLLGTGTIAGRLYDFGTY--PGLVLDPTASPAV-GDIYDVPEALLPVLDEIEEV---YPGQA-SLFVREEQAVLHQGQPVDCLLYPVADAAVTGLP....................... 119
22  1.000e-24 30  Ralstonia metallidurans CH34 gi|48768137||ref|ZP_00272488.1| COG2105: Uncharacterized conserved protein [Rals protmod 1 MPRVFVYGTLRAGEVNDLNRAATRHGIEAPTLVGTGTIAGRLYDFGTY--PGLVLDAAAGP-VAGDIYDIPDALLPVLDEIEEV---YPGQA-TLFVRETQPVALAGAATDCLLYPVADSAVTGL........................ 118
23  2.000e-23 97  Mus musculus gi|51593631||gb|AAH80839.1| Unknown (protein for MGC:103366) [Mus musculus] protmod 1 MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGNW.................................................................................. 67
24  4.000e-23 28  Burkholderia fungorum LB400 gi|48787729||ref|ZP_00283708.1| COG2105: Uncharacterized conserved protein [Burk protmod 1 MQTVFVYGTLRAGEVNDISEAAARNQIAAPNLLGTATVRGHLFDFGSY--PGLVVDE-AGVDVIGDVYEIDDELVAVLDEIEAYPGVEDR-----FLAREVMVKVDGSVVNCRFYPVAPNAVKGLP....................... 119
25  6.000e-23 30  Bacillus cereus ATCC 10987 gi|42781898||ref|NP_979145.1| btrG family protein [Bacillus cereus ATCC 10987] g protmod 1 MHHVFVYGTLRKEQTNAHYMQGAICIVDEAWTYGKTNEGYPAMICS------------NKDKVYGEVYEVNDAVLQKLDELEEYTDLYDRITETIYFGDRE--------IRAFVYVAQD--KEMLKK...................... 113
26  8.000e-23 35  Methanocaldococcus jannaschii DSM 2661 gi|15669708||ref|NP_248521.1| hypothetical protein MJ1514 [Methanocaldococcus ja protmod 1 MEYVFVYGSLRKGFWNHEPYLKNS----KFIGKGKTKEKYAMYV---NIIPYVVENEKISHIV-GEVYEVDEKTLKRIDCLEGHPDYYRRKKVSIIL-------DSGKEIEAWLYF................................. 101
27  8.000e-23 28  Burkholderia cepacia R1808 gi|46318118||ref|ZP_00218621.1| COG2105: Uncharacterized conserved protein [Burk protmod 1 MRHVFVYGTLRAGEANDIGHAAARHGIPAPTLLGAVALPGELYDFGTY--PGMVAGAAGQSLVWGDVYAVDELLLPVLDEIEGVDTLFRQEPVTVELG--------GRAYACVYYPVA............................... 112
28  4.000e-22 29  Vibrio vulnificus CMCP6 gi|27364165||ref|NP_759693.1| hypothetical protein VV10710 [Vibrio vulnificus CM protmod 12 .HLVFVYGTLRKGESNHHYLQ-----HSEFLGGCQSGQEYRLYDLGDYPAVG-----EGNRAVSGEVYLIDDATLQALDKLEDVPVEYRRETIATPFG------------QAWIYLYQD.............................. 107
29  5.000e-22 29  Vibrio vulnificus YJ016 gi|37678614||ref|NP_933223.1| hypothetical protein VV0430 [Vibrio vulnificus YJ0 protmod 12 .HLVFVYGTLRKGESNHHYLQ-----HSEFLGGCQSGQEYRLYDLGDYPAVG-----EGNRAVSGEVYLIDDATLQALDKLEDVPVEYRRETIATPFG------------QAWIYLYQD.............................. 107
30  9.000e-22 28  Burkholderia cepacia R18194 gi|46310642||ref|ZP_00211275.1| COG2105: Uncharacterized conserved protein [Burk protmod 1 MRYVFVYGTLRNGEANDIGHAAARHGIAAPTLLGAAALLGELYDFGTY--PGMIAGSAGKSLVWGDVYEVDDLLVPVLDEIEGVDSLFKPEDVTVELG--------GRQYACLYYPVA............................... 112
31  2.000e-21 33  Vibrio parahaemolyticus RIMD 2210633 gi|28897083||ref|NP_796688.1| hypothetical protein VP0309 [Vibrio parahaemolytic protmod 3 .HLIFVYGTLRKGEYNHHYL-----SSAQFLGLHETDAQFSLYDVGSYPA-----LSEGQRSIQGEVYLIDDDTLVALDKLEDVPVEYRRESIATPFG------------QAWIYLYQD.............................. 98
32  4.000e-21 30  Bacillus thuringiensis serovar konkukian str. 97-27 gi|49479620||ref|YP_036900.1| conserved hypothetical protein, possible butirosin protmod 1 MHHVFVYGTLRKEQSNAHFMQGAICIADEAWTYGK------LFDTNE-GYPAMTYS--NEEKVYGEVYEVNDDVLQKLDKLEEYTDLYDRITETIYLGDRE--------IRAFVYVAQN--KEMLKK...................... 113
33  4.000e-21 32  Bacillus cereus ATCC 14579 gi|30020933||ref|NP_832564.1| Butirosin biosynthesis protein BtrG [Bacillus cere protmod 1 MYHVFVYGTLRRGQTNAHYMLGATCIADRAWTYGKTNEGYP---AMTYSI---------EEQVYGEVYVVNDEILCKLDELEEYTDLYDRITQTVYVADRE--------IEAYVYIAQD--KKMLKK...................... 113
34  5.000e-21 28  Bacillus cereus G9241 gi|47567629||ref|ZP_00238339.1| Butirosin biosynthesis protein BtrG [Bacillus ce protmod 1 MHYVFVYGTLRKKQTNAHYMQGAICIADKAWTNGK------LFDTNE-GYPAMTYS--SEEKVYGEVYEVNDEILHKLDELEEYTDLYDRITQTVY--------ATDREIEAYVYIAQD.............................. 107
35  7.000e-21 29  Burkholderia mallei ATCC 23344 gi|53724117||ref|YP_103232.1| hypothetical protein BMA1592 [Burkholderia mallei protmod 10 MRYVFCYGTLRAGEINDIGRAAATHGIAAPRLVGAVAVAGRLYDFG--NYPGMVAG-GGRDLVWGDVYAIDERLVPVLDEIEEV---YPGVE-GLFVRQRASVELGGRRYDCLYYPV................................ 119
36  1.000e-20 28  Arabidopsis thaliana gi|9758508||dbj|BAB08916.1| unnamed protein product [Arabidopsis thaliana] gi|28 protmod 7 .NLIFVYGTLKRNHRNHFLLEDLSTNDAVYIGQRTTRLQYPLV-TGLYGIPYLINKSGSGQKIRGELYSVSKRGLVRLDELEGIKNHYERLPIEVIEEDDEEEESNGVVLAEAYFAHFGFGERLWEKKGKCGMCEFGNDGVLYVRPKDR 156
37  1.000e-20 29  Burkholderia pseudomallei K96243 gi|53719802||ref|YP_108788.1| hypothetical protein BPSL2193 [Burkholderia pseudo protmod 1 MRYVFCYGTLRAGEINDIGRAAATHGIAAPRLVGAVAVAGRLYDFG--NYPGMVAG-GGRDLVWGDVYAIDERLVPVLDEIEEV---YPGVE-GLFVRQRASVELGGRRYDCLYYPV................................ 110
38  9.000e-20 30  Bacillus anthracis str. `Ames Ancestor` gi|47528111||ref|YP_019460.1| btrg family protein [Bacillus anthracis str. `Ames protmod 1 MHHIFVYGTLRKEQSNAHFMQGAICIADEAWTYGK------LFDTNE-GYPAMTYS--NEEKVYGEVYEVNDDILHKLDELEEYTDLYERITQIVFDGDRE--------IEAYVYIAHD--KNMLKK...................... 113
39  1.000e-19 28  Bacillus cereus ZK gi|52142700||ref|YP_084131.1| conserved hypothetical protein; possible butirosin protmod 1 MHHVFVYGTLRKEQSNAHFMQGAICIADEAWTYGK------LFDTNE-GYPAMTYS--NEEKVYGEVYEVNDDILRKLDELEEYTG---NAETDVYERITQIVFDGDREIEAYVYIAHD--KNMLKK...................... 113
40  4.000e-19 26  Ralstonia solanacearum gi|17428370||emb|CAD15057.1| CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacea protmod 6 ..HVFAYGTLRAGEANDLRVAASRRGIAEPKLIGHATLHGRLYDFGAY--PGLVPDP-TGTAVRGDVYRIDPGLVPVLDTIEAV---YPGGG-ALFLRETHTVMLGSEPLDCIVYPVS............................... 114
41  1.000e-18 32  Bacillus circulans gi|25815169||dbj|BAC41214.1| BtrG [Bacillus circulans] protmod 18 MPNLFVYGTLREGENNHKYMKEAT------LLSRKASIAGSLVDTG-NGYPGLLL---ENQLVAGEWYEVSEETLKRIDELEEYRNLFDRIECQVN---ESGGTHLGWT---YVYNRDDY............................. 127
42  2.000e-18 32  Vibrio cholerae O1 biovar eltor str. N16961 gi|9657130||gb|AAF95687.1| conserved hypothetical protein [Vibrio cholerae O1 bi protmod 3 .HLVFVYGTLRHGESNHTYLQ-----HSQLLGQFETKPEYALYDLGAY--PGLVEGH---QSVHGEVYLVDEHTLAQLDILEDVPVEYRRDTIETPFG------------TAWIYIYQ............................... 97
43  3.000e-18 30  Pseudomonas aeruginosa phage PaP3 gi|27414443||gb|AAL85529.1| ORF.42 [Pseudomonas aeruginosa phage PaP3] gi|274760 protmod 3 ...VFVYGTLMHGFGNHCLLEG-----ARFVGHATSQERGRMYSCGGFPILSFKHRE---DLVTGEVWELPKEMLNNLDRLEGYPGWYDRSPKNFRI--------NGEMITALVY.................................. 103
44  4.000e-18 31  Methanococcoides burtonii DSM 6242 gi|41720279||ref|ZP_00149092.1| COG2105: Uncharacterized conserved protein [Meth protmod 1 MNLLFVYGTLKRGYVNHHLLERS-----TFVLETCTEKKFQILDMGDFP---AVVKDVPVSTIDGELFNVDDSTLSDIDAFEG--EWFSREEVVLQ-----------DSSIAWMYFLSEY............................. 99
45  6.000e-18 23  Anabaena variabilis ATCC 29413 gi|53763952||ref|ZP_00351388.1| COG2105: Uncharacterized conserved protein [Anab protmod 13 ..RVFVYGTLKPGEVNYQRYCAGKVVSAE---KATTLGQL---FALPMGYPAMTTGEST---VHGYLLSFDVRILDALDTLEDYENLYNRLEVKVKNPLGLSLG------WAWVYLMNPAKVEMLKGTHL................... 133
46  8.000e-18 24  Nostoc sp. gi|25530831||pir||AC2216 hypothetical protein all3282 [imported] - Nostoc sp. (s protmod 13 ..RIFVYGTLKPGEENYQRYCAGKVVLAQ---KATTLGQL---FALPIGYPAMTIGEST---VHGYLLSFADLILDALDELEDYENLYNRLEVEVKNPLGLSLG------WAWVYLMNPAKVEMLKGVHL................... 133
47  3.000e-17 27  Caenorhabditis briggsae gi|39586485||emb|CAE73612.1| Hypothetical protein CBG21102 [Caenorhabditis brigg protmod 34 ..........................................................EKSNIEGELYEVDAKKLEILDELEAYPTLYDRKEIEIKL------STDGSIRHAYIYLLRSWRADLLATSMLTTYSSLGPHGRVYVD.... 116
48  3.000e-17 25  Acinetobacter sp. ADP1 gi|50083928||ref|YP_045438.1| hypothetical protein ACIAD0705 [Acinetobacter sp. protmod 1 MNRLFAYGTLRPDQPNAHILAKLNGEWQTVHGVIHTLDWGP-----DQGLPAIVLDS-SAPQVEGLVFSSDEDHWQMLDEFEGF--QYERVMIDVLL-------DSNQWIQAWTYQMNP.............................. 108
49  5.000e-17 31  synthetic construct gi|49080280||gb|AAT49999.1| PA4164 [synthetic construct] protmod 1 MQRLFVYGSLGPGRPNEHLMQKIGGQWQAASLRGRLLEKG--WGAGM-GFPGLAIDA-DGEEIHGHVFVSDAEHWPALDEFEG--SEYRRVATRV-------TLADGAQVDAYVYALRD.............................. 108
50  5.000e-17 30  Pseudomonas aeruginosa UCBPP-PA14 gi|32039379||ref|ZP_00137651.1| COG2105: Uncharacterized conserved protein [Pseu protmod 1 MQRLFVYGSLGPGRPNEHLMQKIGGQWQAASLRGRLLEKG--WGAGM-GFPGLAIDA-DGEEIHGHVFVSDAEHWPALDEFEG--TEYRRVATRV-------TLADGAQVDAYVYALRD.............................. 108
51  5.000e-17 31  Pseudomonas aeruginosa PAO1 gi|9950372||gb|AAG07551.1| hypothetical protein PA4164 [Pseudomonas aeruginosa P protmod 1 MQRLFVYGSLGPGRPNEHLMQKIGGQWQAASLRGRLLEKG--WGAGM-GFPGLAIDA-DGEEIHGHVFVSDAEHWPALDEFEG--SEYRRVATRV-------TLADGAQVDAYVYALRD.............................. 108
52  6.000e-17 28  Bradyrhizobium japonicum USDA 110 gi|27382463||ref|NP_773992.1| hypothetical protein bll7352 [Bradyrhizobium japon protmod 5 ..RLFVYGTLTRGF--DHPMARLLAGHAEFLGKATCRGRLFLI----KHYPGLLLSDAPSDLVHGELFRVPDELLRELDMYEACPTEYLRKLIDV-------TLPDGTAGKAWTY-VYNWPVADLPR...................... 123
53  1.000e-16 29  Sulfolobus tokodaii str. 7 gi|15922533||ref|NP_378202.1| hypothetical protein ST2205 [Sulfolobus tokodaii s protmod 1 MPYLFVYGSLRYGFELHHLLENSR-----FVGLAYT-EGYKMYDLGSY--PGVVKGDGI---IYGEVYEVDDNTILLLDKVEDYRDLYIREKTKVYFDDKRRYYLSD--VHIYVY.................................. 106
54  2.000e-16 23  Microbulbifer degradans 2-40 gi|48861976||ref|ZP_00315874.1| COG2105: Uncharacterized conserved protein [Micr protmod 20 .HYYFTWGTLKQGFPNHD---ANKEVLGDLIGKFTTVKPLSLIVPLAHRIGALTEKTLSQSKLKGEVYLISEAGLAQLDKLENYTNSYVRKTIDL------ANDATGEVINAYIYFINDAEK........................... 148
55  2.000e-16 24  Bacillus clausii KSM-K16 gi|56965545||ref|YP_177279.1| butirosin biosynthesis protein BtrG [Bacillus clau protmod 7 .HRLFVYGTLRKGGTNDHYLQQSELVEDTCW-----------IIGEMHNTPFPIVRFRGQEKIRGELYAVTSEELIRIDELEGYENEYERVECTVYTDESET............................................... 104
56  6.000e-16 31  Photorhabdus luminescens subsp. laumondii TTO1 gi|37528371||ref|NP_931716.1| hypothetical protein plu4552 [Photorhabdus lumines protmod 2 ..RIIVYGSLRRKQGNHHWMTD-----AQWLGDHR-LEGYELYDLGHY--PAVIRGDGS---IECEVYRINSTILTELDDLKDNSREYVRELIQTPYG------------NAWIYLYQ............................... 94
57  7.000e-16 30  Escherichia coli gi|537064||gb|AAA97119.1| ORF_o113 [Escherichia coli] gi|24115466|ref|NP_709976. protmod 2 ..RIFVYGSLRHKQGNSHWMTN-----AQLLGD-FSIDNYQLYSLGHY--PGAV--PGNG-TVHGEVYRIDNATLAELDALRTRGGEYARQLIQTPYG------------SAWMYVYQR-PVDGLKL...................... 102
58  9.000e-16 30  Escherichia coli gi|58177343||pdb|1XHS|A Chain A, Solution Structure Of The Hypothetical Protein protmod 2 ..RIFVYGSLRHKQGNSHWMTN-----AQLLGD-FSIDNYQLYSLGHY--PGAV--PGNG-TVHGEVYRIDNATLAELDALRTRGGEYARQLIQTPYG------------SAWMYVYQR-PVDGLKL...................... 102
59  2.000e-15 22  Deinococcus radiodurans R1 gi|6458003||gb|AAF09909.1| conserved hypothetical protein [Deinococcus radiodura protmod 41 ...VFVYGTLLPGERNAHIAAQG----GEFTVRPATLRGFRLFDLRPESYPGIVPGAAD-DLIHGALLTYGPADWEQLDELEGVPPVYTREQVRL-------TLEGGETLTAWVYVYA............................... 150
60  4.000e-15 30  Rubrobacter xylanophilus DSM 9941 gi|45546106||ref|ZP_00186209.1| COG2105: Uncharacterized conserved protein [Rubr protmod 6 ...LFVYGTLKRGQPNHAALCRGRAERAAVRGRLFALPGYPLAAGTPDPLADAALQERAGRRVRGELYVFGDRRLPELDAFEG----FRPGGESLYVRVLVPVLTPSGTVPAWAYAMPGPPPEGRPLP..................... 149
61  4.000e-15 36  Drosophila melanogaster gi|16648254||gb|AAL25392.1| GH28534p [Drosophila melanogaster] protmod 1 .........................................................................MLNSLDNLEDCEEIYTREMHDMNIGVGEG------TVPCWVYLLQKYPENLLSLRYLSSYENSTTH--PYIMRHRR 68
62  6.000e-15 49  Lytechinus pictus gi|552255||gb|AAA30011.1| troponin C gi|552254|gb|AAA30010.1| unknown troponin C protmod 7 MNRVFVYGTLKRGQPNHFALSEVGNERYTYIGNGFTSTKCPLVIASEHNIPYLMDKEGNGY........................................................................................ 67
63  1.000e-14 29  Thermus thermophilus HB8 gi|55979988||ref|YP_143285.1| hypothetical protein TTHA0019 [Thermus thermophilu protmod 1 MEAVFVYGTLKRGERNHGLVAPYLH-----RVLPGFVEGFRLYHLPPYAYPGMVPGEG---RVFGEVLFLRPEALSLLDALEEEGEEYKRVRVRVETEEG--------PLEAWAYLYLGGLEGALPLP..................... 117
64  2.000e-14 30  Chloroflexus aurantiacus gi|53795238||ref|ZP_00356328.1| COG2105: Uncharacterized conserved protein [Chlo protmod 1 MRPFFVYGTLKRGQSNYARLLAGY----TLREVRAWLPAAAIYTAGPY--PFLVDLVPAGAIVFGELIEVYQRLLQLLDGLEDYGNLYERIVVTVQTADG--------AREAWVYVAGRAAE........................... 120
65  2.000e-14 27  Erwinia carotovora subsp. atroseptica SCRI1043 gi|50122515||ref|YP_051682.1| hypothetical protein ECA3594 [Erwinia carotovora s protmod 2 ..RIIVYGSLRRKQGNSHWMTN-----AQWLGD-CLLAGFELYDLGHY--PAVVPGDGE---IRCEVYRISSSILTELDALKRDGHEYQRELIPTPLG------------NAWIYLYK............................... 94
66  2.000e-14 28  Rhodopseudomonas palustris CGA009 gi|39934360||ref|NP_946636.1| hypothetical protein RPA1285 [Rhodopseudomonas pal protmod 5 ..RLFVYGTLMRGY--DHPMARLLSSNAEFLG--AASIPGRLYLVRHY--PGLVPSDDPADRVHGEVFRLPDEVLAQLDDYEGCRAEYRREIACV-------TLEGGTELDAFVY.................................. 111
67  2.000e-14 27  Escherichia fergusonii gi|22034319||gb|AAL01561.1| unknown [Escherichia fergusonii] protmod 1 MNALFVYGTLRPGHANAHILENIGGEWGTFYERGWGAAA---------DFPGIVLHP-DGPRVEGFLFISDSAHWPMLDEFED---GYDRVEVNV-------TTPDGKQVNAWIYQLQP.............................. 107
68  2.000e-14 29  Thermus thermophilus HB27 gi|46200281||ref|YP_005948.1| hypothetical protein TTC1979 [Thermus thermophilus protmod 1 MEAVFVYGTLKRGERNHGLVAPYLH-----RVLPGFVEGFRLYHLPPYAYPGMVPGEG---RVFGEVLFLRPEALSLLDALEEEGEEYKRVRVRVETEEG--------PLEAWAYLYLGGLEGALPLP..................... 117
69  3.000e-14 26  Yersinia pseudotuberculosis IP 32953 gi|51594806||ref|YP_068997.1| hypothetical protein YPTB0454 [Yersinia pseudotube protmod 2 ..RIIVYGSLRRKQGNSHWMTD-----AQLLGE-HDLEGYEMYNLGHY--PAVIPGDGT---VHCEVYRINSSIMNELDELKSNTKDYRRELIKTPYG------------SAWIYLYR-LPTEGLPRIY.................... 104
70  3.000e-14 28  Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150 gi|56416204||ref|YP_153279.1| hypothetical protein SPA4231 [Salmonella enterica protmod 2 ..RIFVYGSLRQKQGNSHWMTN-----AQLLGDYR-IDNYQLYSLGHY--PGAVPGNGA---VYGEVYRIDNATLAELDALRTRGGEYARQLIQTPYG------------SAWMYVYQR-PVDGLTL...................... 102
71  4.000e-14 24  Clostridium perfringens str. 13 gi|18145086||dbj|BAB81130.1| conserved hypothetical protein [Clostridium perfrin protmod 8 .RKIFVYGSLRTGFFNYEKYLKGKVIKSEL-----GRVKGTLYHMPKKGYPALIEGDG---FVYGEVMTIYENVINAMDLMEGYNNEYNRIEMDVEI------LGKKSSEKCYVY.................................. 115
72  5.000e-14 30  Desulfovibrio desulfuricans G20 gi|53690941||ref|ZP_00346527.1| COG2105: Uncharacterized conserved protein [Desu protmod 22 ..RLFVYGTLKRGYWNHQRFCALYHLHAGFLARGTDD---PLADASRQGTPRFDRPTGDWDLIHGELFTDPQHDLPPIDRLEGFRSMYQRVMVAVLCGR--------TSIPAWTY.................................. 155
73  6.000e-14 30  Sulfolobus solfataricus P2 gi|15898969||ref|NP_343574.1| hypothetical protein SSO2192 [Sulfolobus solfatari protmod 2 ..YLLVYGSLRYGFELNHLVAKSR-----FVGLGY-IEGYEMYDLG--NYPGVIKGDGI---VWGEVYEIDENLIKLLDEVEDYDDLYVREKTRVYFDQ.................................................. 91
74  6.000e-14 34  Pyrobaculum aerophilum str. IM2 gi|18311743||ref|NP_558410.1| hypothetical protein PAE0144 [Pyrobaculum aerophil protmod 1 MPYLFVYGTLKSGCGNHRYLKN-----AQFLGEAE-VEGYTLIGV---IIPYAVEAPGC--KVKGELYRVSQEELEAIDQLE-IPAGYARVEVEARTPWG--------AYKAWMYAY................................ 97
75  7.000e-14 26  Desulfovibrio desulfuricans G20 gi|53690631||ref|ZP_00346374.1| COG2105: Uncharacterized conserved protein [Desu protmod 22 ..RLFVYGTLKRGYWNHQRFCAQAREQAVVWGRLYHLHAGPLADARRQGTPCFGRPTGDWNLIHGELFTDPQRDLPPIDRLEGFRSMYQRVMVAVLCGR--------TSIPAWTYWIPCPP............................ 161
76  1.000e-13 32  Polaromonas sp. JS666 gi|54031959||ref|ZP_00364092.1| COG2105: Uncharacterized conserved protein [Pola protmod 6 LRHVFVYGTLRRGEERDINCLK-----PAPRWVGHASVAGILHHLGAY--PGLVL--GGQGLVRGEVYEITPELERQLDEIEEVSGEYIRREVLVAL.................................................... 97
77  1.000e-11 27  Photobacterium profundum SS9 gi|54307595||ref|YP_128615.1| hypothetical protein PBPRA0381 [Photobacterium pro protmod 4 ...........................ADFLGACKLDSGYALYDLGLY--PALIKNHDSTLPLYGEVYKVDGLTLQALDRLEEYPTLYDRHLVSTVWG------------KAWVYVYQ............................... 80
78  6.000e-11 26  Bacillus subtilis subsp. subtilis str. 168 gi|16078514||ref|NP_389333.1| hypothetical protein BSU14500 [Bacillus subtilis s protmod 5 ...LFVYGTLRKHEKNHHLLAQSANEQARTKGSLFAAKEGPTVVF---------NDEDEGY-IYGEVYEADELCIHKLDQFQGY------HKQTVFVETDVGIKI------ALIYFMNK.............................. 101
79  1.000e-10 30  Dichelobacter nodosus gi|3482869||gb|AAC33396.1| vrlH [Dichelobacter nodosus] gi|7469108|pir||T17387 v protmod 22 ..RLFVYGTLKRGYWNHQRFCALYHLHAGFLSRGTAD---PLADARRQGTSRFGRPTGDWDLIHGELFTDPQRDLPPIDRLEGFRSMYQRVMV----------PAARGSISCAVWTYTMYAP........................... 160
80  3.000e-10 22  Trichodesmium erythraeum IMS101 gi|48895767||ref|ZP_00328751.1| COG2105: Uncharacterized conserved protein [Tric protmod 2 ....FVYGTLKPGEVNYQFYCAEYVVHFFP-----AVAKGVLYKL-PIGYPAMTKGDSN---VHGFVLLFNPLVLSELDKLEDYKNEYQRQIINTFSSDGKYLG------KAWSYLMSQERVELL........................ 115
81  5.000e-10 26  Pyrococcus horikoshii OT3 gi|14590695||ref|NP_142763.1| hypothetical protein PH0828 [Pyrococcus horikoshii protmod 9 ..RIAVYGTLRKGKPLH-WYLKGAKFLGEDW-----IEGYQLYF---EYLPYAVKGKG---KLKVEVYEVDKETFERINEIE-IGTGYRLVEVSTKFG................................................... 91
82  5.000e-10 26  Pyrococcus horikoshii gi|56966298||pdb|1V30|A Chain A, Crystal Structure Of Uncharacterized Protein Ph protmod 9 ..RIAVYGTLRKGKPLH-WYLKGAKFLGEDW-----IEGYQLYF---EYLPYAVKGKG---KLKVEVYEVDKETFERINEIE-IGTGYRLVEVSTKFG................................................... 91
83  6.000e-10 25  Thermosynechococcus elongatus BP-1 gi|22298686||ref|NP_681933.1| hypothetical protein tlr1143 [Thermosynechococcus protmod 11 ..RLFVYGTLKPGYPPHDRFC-------RPWLSAHALVRGRLYHL-PMGYPGLTPEEG---WVQGELLLFPSRLLAQLDAFEGYSNAYHRQEVPVYDLTHKPLGT------AWAYIVRDFNGEWLP....................... 134
84  8.000e-10 27  Pyrococcus furiosus DSM 3638 gi|18977018||ref|NP_578375.1| hypothetical protein PF0646 [Pyrococcus furiosus D protmod 9 ..RIAVYGTLRKGKPLH-WYLK----EAKFLGE-DWIKGYQLYF---EFLPYAVKGEG---KLKVEVYEVDKETFERINEIET-GAGYKLVEVSTKFG................................................... 91
85  1.000e-09 33  Streptomyces avermitilis MA-4680 gi|29609331||dbj|BAC73382.1| hypothetical protein [Streptomyces avermitilis MA-4 protmod 16 ....FVYGTLRPGEHNHDLFL---------RGRTESEEPARLRDAVLYGYPYAVEEPGAGP-VCGELVEAYGELLGALDRLEEYGNLYERVALHVTRGDGAAV.............................................. 116
86  3.000e-09 25  Mycobacterium tuberculosis H37Rv gi|15608063||ref|NP_215438.1| hypothetical protein Rv0923c [Mycobacterium tuberc protmod 6 ................HPYFAYGSNLCAHQMASRCPDAGAPRAVLSDHN--WLINQRGAGNKVHGVLWQLSERDLVRLDSAEGVPVRYRRERLTVH--------TDDTALPAWVY.................................. 102
87  3.000e-09 29  Gloeobacter violaceus PCC 7421 gi|37520966||ref|NP_924343.1| hypothetical protein glr1397 [Gloeobacter violaceu protmod 16 .ALLFVYGTLRQGECNHGLLRGRADWVREATCRGH------LYSVEDH-YPALSLD-KAAPPVVGELYTARAALMIDLDRLEGIEEQYYR........................................................... 100
88  4.000e-09 27  Clostridium thermocellum ATCC 27405 gi|48857932||ref|ZP_00311906.1| COG2105: Uncharacterized conserved protein [Clos protmod 1 ..........MKDFCNYKRYLEGR------ISRITPGKTYGLLYHLPEGYPGLLPGSGI---IEGEIVEVDKKLLKSLDRLEGYNNLYVRELRNIL-------TEDGEEVPCWIYIYANYAKE.......................... 105
89  2.000e-08 23  Nostoc punctiforme PCC 73102 gi|53688735||ref|ZP_00111819.2| COG2105: Uncharacterized conserved protein [Nost protmod 2 ......YGTLKPGEANYKKYCAGKVVDVK-----KAFVEGKLF-ALPMGYPAMTLG---NSKVYGYLLSFPPRILNELDVLENYENLYNRQIIEVYEPQSLSLGL------ALVYLMALEQVEQL........................ 113
90  1.000e-07 28  Geobacillus kaustophilus HTA426 gi|56420171||ref|YP_147489.1| hypothetical protein GK1636 [Geobacillus kaustophi protmod 7 ..RVFVYGTLLTGEENHEVVAPY------VRAVCSGKVNGRLYNVGPYPA----LVLGEEGEVEGEWLTVTEEGLKAMDELEDYNNEYERVWVR....................................................... 93
91  2.000e-07 22  Synechocystis sp. PCC 6803 gi|16331523||ref|NP_442251.1| hypothetical protein slr0491 [Synechocystis sp. PC protmod 14 ..KVFVYGTLMPGECNHQAYC---HRQIEPPTLGYVL--GQIYHLQYFGYPALAIGE---DRVWGYCLTFPPGSLEHLDSLEDYENVYDRCWAEIFDPQDQVMTE------AWLYRMDSRKIEQYGGIYL-------PHGR........ 139
92  2.000e-07 26  Thermoanaerobacter tengcongensis MB4 gi|20808041||ref|NP_623212.1| hypothetical protein TTE1613 [Thermoanaerobacter t protmod 1 MKKLFVYGTLMRGFENYNKYLKDKVKE---IKKGYTY--GNLYHLIRESCPALIEG---KEKIWGEIITFYDNVLSSIDELELYEIMYLREKREVFYENGE-----KEYIDVYVY.................................. 109
93  4.000e-07 23  Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough gi|46580335||ref|YP_011143.1| hypothetical protein DVU1926 [Desulfovibrio vulgar protmod 7 ..RVFVYGTLKRGGRHHAAHC------ADALRVRTGCTRGRLVDL-PAGYPTL-HVPGSSALVRGEVFADAPAALHRLDKLE----EFAPGGISLYLRVLLPVLVDDVLLPCWTY.................................. 146
94  1.000e-06 30  Bacillus halodurans C-125 gi|10174229||dbj|BAB05331.1| BH1612 [Bacillus halodurans C-125] gi|11387352|sp|Q protmod 15 .......................................GHLYDSGL-GYPALIADEKGG-KVVGELYEINEQHLVSLDELEDYANLYERVLHTLE-----------DGSHCYLYVVTPDSP........................... 89
95  3.000e-06 24  Mycobacterium avium subsp. paratuberculosis str. k10 gi|41406966||ref|NP_959802.1| hypothetical protein MAP0868c [Mycobacterium avium protmod 6 ................HLYFAYGSNLCARQMAQRCPDAADPRAVLADHD--WLINQRGAGNQVHGVVWRISDGDLATLDSAEGVPVRYRRDRLTVHTDDG--------PAPAWVYIVTPGPPRPGYLP--KIVDGATQHGLP....... 130
96  6.000e-06 22  Arabidopsis thaliana gi|30682389||ref|NP_180015.2| avirulence-responsive protein-related / avirulence protmod 7 MHSVFVYGSLMADDVV-RLLLNRIPQTASATLPDLFSIKGRVY-------PAII--PAKSDKVSGKVFGITDDELNVLDEFEDV--EYERENVQVLLTDSSDEKLQTKT---YVWAKKDDPD........................... 114
97  1.000e-05 26  Arabidopsis thaliana gi|4337197||gb|AAD18111.1| similar to avrRpt2-induced protein 2 [Arabidopsis tha protmod 7 MHSVFVYGSLMADDVV-RLLLNRIPQTASATLPDLFSIKGRVY-------PAII--PAKSDKVSGKVFGITDDELNVLDEFEDV--EYERENVQVLLTVNE................................................ 96
98  3.000e-05 19  Clostridium thermocellum ATCC 27405 gi|48858565||ref|ZP_00312516.1| hypothetical protein Chte02002172 [Clostridium t protmod 22 .....................AYRCPTAKVLGSAK-LTGYRLLFRGGNGGAVATIEKQKGERVPVLLWRIMPNDEKALDRYEGYPHLYRKETVKVRF--------KGQWVPAMVYIMNEGRPLGAPGRYY................... 121
99  3.000e-05 26  Cytophaga hutchinsonii gi|48856461||ref|ZP_00310618.1| COG2105: Uncharacterized conserved protein [Cyto protmod 2 ..HIFVYGTLKKTYKNLNAFTAVFHANTEWLC--HAVVKGDMY--MKDWYPALKL--GGENLVFGEIYRINSPLLETIDQYEDITSDYVRRHIRI------------DDMECWIY.................................. 113
100  8.000e-05 22  Methanopyrus kandleri AV19 gi|20094411||ref|NP_614258.1| hypothetical protein MK0975 [Methanopyrus kandleri protmod 18 ..RVFAYGTLT-----DPEMVVGVLNRLPTIIYPAVLEGYELAVGGRYN----TIREREGSEVKGALLVLSDEDIRAIDRYEGYPVLYERERVEVKTSLG--------SYEAYVYIAR............................... 120
101  9.000e-05 25  Pseudomonas fluorescens PfO-1 gi|48729374||ref|ZP_00263125.1| COG2105: Uncharacterized conserved protein [Pseu protmod 14 ......................................KGRLSQAGAMGFPGLVIAE-DGDVIEGYVFASESEHWAALDEFEG--AEYQRVLTKVKL-------DNGTTMDAYVYALK............................... 88
102  2.000e-04 21  Bdellovibrio bacteriovorus HD100 gi|42521893||ref|NP_967273.1| hypothetical protein Bd0269 [Bdellovibrio bacterio protmod 66 ..RFFVYGSFCEGMVHFSKIQNFVESSVFARVKATA---YRLKV----GFPAVVK--GGSDLVPGQLIELSDLLLSLMDEFHGYNSLYSREEIEVH------PEGMSAPVKAWIYFLNP-----LKLP..................... 179
103  2.000e-04 26  Methylococcus capsulatus str. Bath gi|53757147||gb|AAU91438.1| conserved hypothetical protein [Methylococcus capsul protmod 32 ...LFAYGTL-----------QLPEVMAAVTGRTFAAVPAWLFDHARYRYPGL--RRETGAVTAGTLFLLDPQALARLDRFED--GFYTRTGVMVSTVELGCQ-------PAQVYLIPPCSEHLLVYRGWSLDDFIRTHASAYVRRCRR 161
104  2.000e-04 22  Arabidopsis thaliana gi|42567302||ref|NP_194859.2| avirulence-responsive protein-related / avirulence protmod 10 ...LFVYGSLQEPEVVYVLLNRVDHVSAVLSGFHRFRLKGRVY---------PTILPDGTGKVNGKVLKITDDELKMLDEFEDV--EYDRKTVEVMLTDTSEKLQVETYVW...................................... 108
105  3.000e-04 22  Oryza sativa (japonica cultivar-group) gi|50905223||ref|XP_464100.1| avrRpt2-induced protein 2-like [Oryza sativa (japo protmod 8 .HRVFVYGTLMAEE-----------VVRVLIGRSPSSSPAVLPNHQRFSIKGRVYLPVDGKEVSGKVFKITDRELNVLDIFED--EEYVKRTVEI------SLTDTSEKLLAYAYLYGEWDFEEWKRVHLEDY................ 133
106  3.000e-04 22  Arabidopsis thaliana gi|7270033||emb|CAB79849.1| AIG2-like protein [Arabidopsis thaliana] gi|2827526| protmod 12 ...LFVYGSLQEPEVVY-VLLNRVPDHVSAVLSGLFRLKGRVY---------PTILPDGTGKVNGKVLKITDDELKMLDEFEDV--EYDRKTVEVMLTDTSEKLQVETYVW...................................... 108
107  3.000e-04 24  Clostridium thermocellum ATCC 27405 gi|48860534||ref|ZP_00314459.1| hypothetical protein Chte02000279 [Clostridium t protmod 1 MKRLYIYGS-------NLNLQQMEKRCPTARVYGKGELKFRLLFKGVPNNAYATIEPFKGGKVPVLVWEVKPKDEKALDIYEGFPNFYYKKDLEVEL-------ESGEIVTAMVYIMTN.............................. 107
108  6.000e-04 27  Rhodopirellula baltica SH 1 gi|32477349||ref|NP_870343.1| hypothetical protein RB12151 [Rhodopirellula balti protmod 21 ....FVYGTLCLGQ------CREKCWPLTPLSVHPAWVEGTL--FGREDYPAL--RPGNQR-VGGECWRDTERVTTVLDEIEGHPNLYDRVELRANL.................................................... 111
109  7.000e-04 27  Clostridium perfringens str. 13 gi|18144070||dbj|BAB80118.1| conserved hypothetical protein [Clostridium perfrin protmod 40 ...................................................YADIIPCEGEKVYGAIYEISLNDLKNLDKYEEYSDLYEKIDLIVQ-------DINGISYEAFAYVMNEKGDKTPDKRYLD.................. 112
110  8.000e-04 21  Ralstonia eutropha JMP134 gi|46131528||ref|ZP_00202612.1| COG0154: Asp-tRNAAsn/Glu-tRNAGln amidotransferas protmod 482 ..RVAVCGAHLQGQPLHHQLADRG---ARLVARTRTAPCYRFYALSGEGPPGLVRVAEGGAAIEVEVWELPQ............................................................................. 550
111  1.000e-03 22  Oryza sativa (japonica cultivar-group) gi|53792757||dbj|BAD53793.1| putative avrRpt2-induced AIG2 protein [Oryza sativa protmod 21 .HSVFVYGSLMQDEPNYHRF----------------NIKGRIY-------PAIL--PVQSKKVAGKVITVTDAELQILDEFEDV--EYVRTRVEISLTDTSETMLADTYVWA..................................... 122
112  0.003 32  Microbulbifer degradans 2-40 gi|48861498||ref|ZP_00315399.1| COG0210: Superfamily I DNA and RNA helicases [Mi protmod 4 ..HIFTYGSLMRGDGKYRHLSAAATGIKRVKIVGQSAESYP-VAFRHPSAPWLT----------GQLYNVEPSDLQKLDAFEG--SYYQRETIQV--------IADGTPYQADIYLLK............................... 107



Contact us